DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and CG3335

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster


Alignment Length:340 Identity:70/340 - (20%)
Similarity:122/340 - (35%) Gaps:84/340 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QLWMGSLESYMTENFIIAAFRKMGEDPTT-VRLMRNKYTGEPAGYCFVNFISDDHALDAMHKLNG 70
            :::..:|....||..:...|.:.|  |.. |.|..:|.|.:..|:..|.::..:|||.|.:.|:|
  Fly   365 RIFFRNLAYTTTEEDLRKLFEQFG--PVVEVNLPLDKLTRKIKGFGTVTYMMPEHALKAFNTLDG 427

  Fly    71 KPIPG------------TNPIVRFRLNSASNSY------KLPGNEREFSVW----VGDLSSDVDD 113
            ....|            .||......|.||.|:      ||..|.::...|    :|..:     
  Fly   428 TDFHGRLLHLLPSKDIEKNPKEDLDENDASLSFKEKKALKLKKNAQKPIGWNTLFLGANA----- 487

  Fly   114 YQLYKVFSSKFTSIKTAKV-ILDSLGFSKG--YGFVRFGIED-----EQKSALYDMNGYIGLGTK 170
              :.::.:.:|   ||:|. |||:   |.|  ...||..:.:     |.|..|.:....:....:
  Fly   488 --VAEILAKQF---KTSKERILDT---SDGGSSAAVRLALGETQVVIEMKRFLEEEGVRLDAFDE 544

  Fly   171 PIK-------ICNAVPKPK--SELG------GAVGEGNTNYGYGSGMTAAGGTDYSQYYDPTSTY 220
            |.|       :...:|...  ||:.      |.:|.        ..:..:|.|...:|.||    
  Fly   545 PAKKRSNTVILAKNLPAATEISEITPIFSRFGPIGR--------IVLPPSGVTALIEYCDP---- 597

  Fly   221 WQGYQAWQGYYEQAGASITDAAAYYQQAMSQSHSN--------PQTLAQHAEAWSAQRSAQYEQQ 277
               .:|.|.:.:.|.:...:|..|.:.|..|..:.        |::..:..|....:........
  Fly   598 ---LEARQAFKKLAYSKFKNAPLYLEWAPEQVFTKTLSGEPVIPKSEPKPKEEVKPEEKPIVNDA 659

  Fly   278 QQQQTASAANGAEDE 292
            :..:..|.|..|:||
  Fly   660 KPDEEDSRAEDADDE 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 24/95 (25%)
RRM2_SECp43 99..180 CDD:241056 18/99 (18%)
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011 19/76 (25%)
RRM4_RBM19 552..623 CDD:241013 15/85 (18%)
RRM <638..845 CDD:223796 7/37 (19%)
RRM5_RBM19_like 679..760 CDD:240764
RRM6_RBM19 785..864 CDD:241015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463929
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.