DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and SLIRP1

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster


Alignment Length:65 Identity:26/65 - (40%)
Similarity:34/65 - (52%) Gaps:9/65 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 VWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVILDS-LGFSKGYGFVRFG-------IEDEQKSAL 158
            ::||:|...|...:|...| .:|..:.:|.||.|. .|.|||||||.|.       ||:|||..|
  Fly    17 IFVGNLPWTVGHQELRGYF-REFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKHIL 80

  Fly   159  158
              Fly    81  80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054
RRM2_SECp43 99..180 CDD:241056 26/65 (40%)
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 26/65 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.