DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and tra2

DIOPT Version :10

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster


Alignment Length:111 Identity:27/111 - (24%)
Similarity:41/111 - (36%) Gaps:34/111 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VRLMRNKY-------------TGEPAGYCFVNF--ISDDHALDAMHKLNGKPIPGTNPIVRFRLN 85
            ||.:.|||             |....|:||:.|  :||..|  |....:|..:.|....|.|.:.
  Fly   113 VRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARA--AKDSCSGIEVDGRRIRVDFSIT 175

  Fly    86 SASNSYKLPG----------NEREFS------VWVGDLSSDVDDYQ 115
            ..::: ..||          ..|.||      |:....:|..|:|:
  Fly   176 QRAHT-PTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYR 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:410022 18/68 (26%)
RRM2_SECp43_like 99..178 CDD:409781 6/23 (26%)
Trnau1ap 210..330 CDD:465438
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 18/63 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.