DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and C6orf52

DIOPT Version :10

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_011512874.1 Gene:C6orf52 / 347744 HGNCID:20881 Length:207 Species:Homo sapiens


Alignment Length:138 Identity:29/138 - (21%)
Similarity:56/138 - (40%) Gaps:18/138 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 QYYDPTSTYWQG--YQAWQGYYEQAGASITDAAAYYQQAMSQSHSNPQ-------------TLAQ 261
            |.:.|:.:|..|  |....|.|..:|.|...|.....:....:|..|:             .||:
Human    58 QEFQPSQSYRYGNWYARQHGSYLLSGYSYGCAVDGNGKDCFSAHETPEHTAGTLVMPKETTPLAE 122

  Fly   262 HAEAWSAQRSAQYEQQQQQQTASAAN---GAEDENGLVEHKFVLDVDKLNREAIDADRRLYDALE 323
            :.:....:.::||..|...:....:|   .|....|:.:....|::::.|:|.:.....|||:|.
Human   123 NQDEDPLEVTSQYVAQADLKLPDLSNSLVSASQSVGVTDPHLHLNIEESNQEFMVKSEELYDSLM 187

  Fly   324 SSKWLPIE 331
            :..|.|::
Human   188 NCHWQPLD 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:410022
RRM2_SECp43_like 99..178 CDD:409781
Trnau1ap 210..330 CDD:465438 28/135 (21%)
C6orf52XP_011512874.1 Trnau1ap 55..202 CDD:465438 29/138 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.