DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and Rbm34

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001014037.1 Gene:Rbm34 / 307956 RGDID:1310161 Length:428 Species:Rattus norvegicus


Alignment Length:132 Identity:37/132 - (28%)
Similarity:63/132 - (47%) Gaps:12/132 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 FVNFISDDHALDAMHKLNGKPIPGTNPIVRFRLNSASNSYKLPGNEREFSVWVGDLSSDVDDYQL 116
            :|.|..:..|..|:.: ||..|...   .|.|::.||.:    .:..:.||:||:|...||:..|
  Rat   245 YVVFKEERAAAKALQR-NGAQIAEG---FRIRVDLASET----ASRDKRSVFVGNLPYRVDESAL 301

  Fly   117 YKVFSSKFTSIKTAKVILDSL-GFSKGYGFVRFGIEDEQKSALYDMNGYIGLGTKPIKICNAVPK 180
            .:.|.. ..||...:::.:.| |..:|:|:|.|...|....|| .:|....:|.| :::..:|.|
  Rat   302 EEHFLD-CGSIVAVRIVRNPLTGVGRGFGYVLFENTDAVHLAL-KLNNSELMGRK-LRVMRSVNK 363

  Fly   181 PK 182
            .|
  Rat   364 EK 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 11/37 (30%)
RRM2_SECp43 99..180 CDD:241056 24/81 (30%)
Rbm34NP_001014037.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..106
RRM 73..364 CDD:223796 35/129 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..152
RRM1_RBM34 183..274 CDD:240840 9/32 (28%)
RRM2_RBM34 286..358 CDD:240841 23/74 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..428 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.