DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and csx1

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_594243.1 Gene:csx1 / 2542151 PomBaseID:SPAC17A2.09c Length:632 Species:Schizosaccharomyces pombe


Alignment Length:202 Identity:74/202 - (36%)
Similarity:107/202 - (52%) Gaps:20/202 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWMGSLESYMTENFIIAAFRKMGEDPTTVRLMRNKYTGEPA--GYCFVNFISDDHALDAMHKLNG 70
            ||||.||.:|...||...:..:.| |..|::||:|.:....  .||||.|.|...|..|:.|.|.
pombe    87 LWMGDLEPWMDATFIQQLWASLNE-PVNVKVMRSKASSSETLISYCFVQFSSSAAAERALMKYNN 150

  Fly    71 KPIPGTNPIVRFRLNSAS------NSYKLPGNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKT 129
            ..|||.:  ..|:||.|:      |::  ...:.|||::||||....:|..|:..|.|.:.|..:
pombe   151 TMIPGAH--CTFKLNWATGGGIQHNNF--VSRDPEFSIFVGDLLPTTEDSDLFMTFRSIYPSCTS 211

  Fly   130 AKVILDSL-GFSKGYGFVRFGIEDEQKSALYDMNGYIGLGTKPIKICNAVPKPKSELG-----GA 188
            ||:|:|.: |.|:.||||||..|.||:.||..|.||:..| :|::|..|.||.::.:.     |.
pombe   212 AKIIVDPVTGLSRKYGFVRFSSEKEQQHALMHMQGYLCQG-RPLRISVASPKSRASIAADSALGI 275

  Fly   189 VGEGNTN 195
            |....:|
pombe   276 VPTSTSN 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 32/89 (36%)
RRM2_SECp43 99..180 CDD:241056 36/81 (44%)
csx1NP_594243.1 RRM 67..367 CDD:223796 74/202 (37%)
RRM1_NGR1_NAM8_like 86..168 CDD:241055 32/83 (39%)
RRM2_NGR1_NAM8_like 181..260 CDD:241057 35/79 (44%)
half-pint <217..>577 CDD:130706 26/67 (39%)
RRM3_NGR1_NAM8_like 296..367 CDD:240792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I2755
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001306
OrthoInspector 1 1.000 - - otm47328
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1842
SonicParanoid 1 1.000 - - X1010
TreeFam 1 0.960 - -
76.900

Return to query results.
Submit another query.