DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and SPBC23E6.01c

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_596601.2 Gene:SPBC23E6.01c / 2540551 PomBaseID:SPBC23E6.01c Length:473 Species:Schizosaccharomyces pombe


Alignment Length:182 Identity:83/182 - (45%)
Similarity:118/182 - (64%) Gaps:9/182 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWMGSLESYMTENFIIAAFRKMGEDPTTVRLMRNKYTGEPAGYCFVNFISDDHALDAMHKLNGKP 72
            ||||.||.::||.||...:..:|: ...|:|:||:|||..||||||.|.|...|..|| .:|.||
pombe    95 LWMGELEPWVTEAFIQQVWNTLGK-AVKVKLIRNRYTGMNAGYCFVEFASPHEASSAM-SMNNKP 157

  Fly    73 IPGTNPIVRFRLNSASNS---YKLPGNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVIL 134
            |||||.:  |:||.||..   .|......|:|::|||||.:|:::.:|.:|:|::.|.|:||::.
pombe   158 IPGTNHL--FKLNWASGGGLREKSISKASEYSIFVGDLSPNVNEFDVYSLFASRYNSCKSAKIMT 220

  Fly   135 D-SLGFSKGYGFVRFGIEDEQKSALYDMNGYIGLGTKPIKICNAVPKPKSEL 185
            | ....|:|||||||..|::|||||.:|.|.| .|.:||::..|.||.|:.:
pombe   221 DPQTNVSRGYGFVRFTDENDQKSALAEMQGQI-CGDRPIRVGLATPKSKAHV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 42/81 (52%)
RRM2_SECp43 99..180 CDD:241056 37/81 (46%)
SPBC23E6.01cNP_596601.2 RRM 70..376 CDD:223796 83/182 (46%)
RRM1_NGR1_NAM8_like 94..173 CDD:241055 42/81 (52%)
RRM2_NGR1_NAM8_like 185..264 CDD:241057 36/79 (46%)
RRM3_NGR1_NAM8_like 302..373 CDD:240792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2705
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001306
OrthoInspector 1 1.000 - - otm47328
orthoMCL 1 0.900 - - OOG6_102296
Panther 1 1.100 - - LDO PTHR47640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1842
SonicParanoid 1 1.000 - - X1010
TreeFam 1 0.960 - -
98.900

Return to query results.
Submit another query.