DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and usp109

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_596836.2 Gene:usp109 / 2540117 PomBaseID:SPBC1289.12 Length:365 Species:Schizosaccharomyces pombe


Alignment Length:273 Identity:56/273 - (20%)
Similarity:111/273 - (40%) Gaps:55/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWMGSLESYMTENFIIAAFRKMGEDPTTVRLMRNKYTGEPAGYCFVNFISDDHALDAMHKLNGKP 72
            ||:.:||.:|.|::|.|.|    |:...|....:..:|.....|.:.|.|.|.|.:|:.:.:.:.
pombe     5 LWLNNLEEWMNEDYIRAIF----ENVRKVNYYEDGESGAILKTCCIEFESQDAARNALERQSTQR 65

  Fly    73 IPGTNPIVRFRLNSASN----SYKLPGNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVI 133
            :...|||   .|:....    ||        :.:::.::..:|.:..:..:| .::..| :|:|:
pombe    66 LISGNPI---SLDVVPEWQKPSY--------YMLFISNIDPEVSENDIKYLF-QRYNFI-SARVL 117

  Fly   134 LDSLGFSKGYGFVRFGIEDEQKSALYDMNGYIGLGTKPIKICNAVPKPKSELGGAVGEGNTNYGY 198
            ....|.|....|:....|.:.::|..:|.|...|  |...:.::|...|:....:.|      .|
pombe   118 RCVDGTSTSIAFIWLANESDIQNAQVEMQGAFCL--KRSILVHSVKSDKNTYLSSPG------FY 174

  Fly   199 GSGMTAAGGTDYSQYYDPTSTYWQGY--------QAWQGYYEQAG-----------ASITDAAAY 244
            |:..      ..:|:.||.:|....:        |..:.|:...|           ..|..|..|
pombe   175 GTPQ------PLNQFTDPNNTAVYVHQLPENITTQELRSYFLHFGEILYTQVNNNSGRIVFAQRY 233

  Fly   245 Y-QQAMSQSHSNP 256
            : :||:::.::.|
pombe   234 FAEQAINEMNNFP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 22/85 (26%)
RRM2_SECp43 99..180 CDD:241056 15/80 (19%)
usp109NP_596836.2 RRM_SF 5..>58 CDD:302621 17/56 (30%)
RRM 8..285 CDD:223796 54/270 (20%)
RRM_SF 88..158 CDD:240668 14/73 (19%)
RRM_SF 188..256 CDD:302621 10/59 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.