DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and Sfpq

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001020442.1 Gene:Sfpq / 252855 RGDID:727923 Length:699 Species:Rattus norvegicus


Alignment Length:345 Identity:74/345 - (21%)
Similarity:128/345 - (37%) Gaps:91/345 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CQLWMGSLESYMTENFIIAAFRKMGEDPTTVRLMRNKYTGEPAGYCFVNFISDDHALDAMHKLNG 70
            |:|::|:|.:.:||:.....|.|.|| |..|.:.:.|      |:.|:...|...|..|..:|:.
  Rat   289 CRLFVGNLPADITEDEFKRLFAKYGE-PGEVFINKGK------GFGFIKLESRALAEIAKAELDD 346

  Fly    71 KPIPGTNPIVRFRLNSASNSYKLPGNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVILD 135
            .|:.|....|||..::|:.|             |.:||..|.:..|.:.| |:|..|:.|.||:|
  Rat   347 TPMRGRQLRVRFATHAAALS-------------VRNLSPYVSNELLEEAF-SQFGPIERAVVIVD 397

  Fly   136 SLGFSKGYGFVRFGIEDEQKSALYDMN-GYIGLGTKPIKICNAVPKPKSELGGAVGEGNTNYGYG 199
            ..|.|.|.|.|.|..:...:.|....: |...|.|.|..:   :.:|..:|....|         
  Rat   398 DRGRSTGKGIVEFASKPAARKAFERCSEGVFLLTTTPRPV---IVEPLEQLDDEDG--------- 450

  Fly   200 SGMTAAGGTDYSQYYDPTSTYWQGYQAWQGYYEQAGASITDAAAYYQQAMSQSHSNPQTLAQH-- 262
                                                  :.:..|.......:....|...|||  
  Rat   451 --------------------------------------LPEKLAQKNPMYQKERETPPRFAQHGT 477

  Fly   263 -----AEAWSAQRSAQYEQQQQQQTASAANGAED------ENGLVEHKF-VLDVDKLNREAIDAD 315
                 ::.|.:  ..:.|:||::|.......|:|      |:...||:. :|..|.:.|:   .:
  Rat   478 FEYEYSQRWKS--LDEMEKQQREQVEKNMKDAKDKLESEMEDAYHEHQANLLRQDLMRRQ---EE 537

  Fly   316 RRLYDALESSKWLPIEQLEV 335
            .|..:.|.|.:....:::::
  Rat   538 LRRMEELHSQEMQKRKEMQL 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 24/82 (29%)
RRM2_SECp43 99..180 CDD:241056 24/81 (30%)
SfpqNP_001020442.1 RRM1_PSF 288..358 CDD:410000 22/75 (29%)
RRM2_PSF 364..443 CDD:410003 26/95 (27%)
NOPS_PSF 434..530 CDD:240583 20/147 (14%)
PRK12704 478..>586 CDD:237177 16/85 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.