DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and F07D3.3

DIOPT Version :10

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_505443.2 Gene:F07D3.3 / 184140 WormBaseID:WBGene00008556 Length:260 Species:Caenorhabditis elegans


Alignment Length:73 Identity:21/73 - (28%)
Similarity:32/73 - (43%) Gaps:14/73 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ERERKRRKKLQTQYLRQKVHYTWEEKIMGKRERKRERERERERERKVREKWRGEGTAVEERKRER 78
            ||.||.|::|..|..::|.      ::..:.|...:..|:.|.|        ....|..|.||:|
 Worm   566 ERLRKEREELVLQKKKEKA------RLQAEAEAAEDARRQAEAE--------AAAEAAAEAKRKR 616

  Fly    79 ERNREARK 86
            |..|||.:
 Worm   617 ELEREAAR 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:410022 21/73 (29%)
RRM2_SECp43_like 99..178 CDD:409781
Trnau1ap 210..330 CDD:465438
F07D3.3NP_505443.2 sex-lethal <1..>163 CDD:273740
RRM_SF 13..93 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.