DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and CIRBP

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens


Alignment Length:194 Identity:52/194 - (26%)
Similarity:80/194 - (41%) Gaps:41/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 EFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVILD-SLGFSKGYGFVRFGIEDEQKSALYDMN 162
            |..::||.||.|.::..|.:|| ||:..|....|:.| ....|:|:|||.|...|:.|.|:..||
Human     5 EGKLFVGGLSFDTNEQSLEQVF-SKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMN 68

  Fly   163 GYIGLGTKPIKICNAVP----KPKSELGGAVG----------------EGNTNYGYGSGM--TAA 205
            |. .:..:.|::..|..    :.:...||:.|                .|..:.|||...  :.:
Human    69 GK-SVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRS 132

  Fly   206 GGTDYSQYYDPTSTYWQGYQAWQGYYEQ-AGASITDAAAYYQQAMSQSHSNPQTLAQHAEAWSA 268
            ||      |..:..|:.......||.:: :|.|..|:...|    .:|||...||     .|.|
Human   133 GG------YGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSY----GKSHSEGATL-----LWPA 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054
RRM2_SECp43 99..180 CDD:241056 28/85 (33%)
CIRBPNP_001287758.1 RRM <3..>90 CDD:223796 28/86 (33%)
RRM_CIRBP_RBM3 6..85 CDD:240895 27/80 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.