DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and CIRBP

DIOPT Version :10

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens


Alignment Length:194 Identity:52/194 - (26%)
Similarity:80/194 - (41%) Gaps:41/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 EFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVILD-SLGFSKGYGFVRFGIEDEQKSALYDMN 162
            |..::||.||.|.::..|.:|| ||:..|....|:.| ....|:|:|||.|...|:.|.|:..||
Human     5 EGKLFVGGLSFDTNEQSLEQVF-SKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMN 68

  Fly   163 GYIGLGTKPIKICNAVP----KPKSELGGAVG----------------EGNTNYGYGSGM--TAA 205
            |. .:..:.|::..|..    :.:...||:.|                .|..:.|||...  :.:
Human    69 GK-SVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRS 132

  Fly   206 GGTDYSQYYDPTSTYWQGYQAWQGYYEQ-AGASITDAAAYYQQAMSQSHSNPQTLAQHAEAWSA 268
            ||      |..:..|:.......||.:: :|.|..|:...|    .:|||...||     .|.|
Human   133 GG------YGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSY----GKSHSEGATL-----LWPA 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:410022
RRM2_SECp43_like 99..178 CDD:409781 27/79 (34%)
Trnau1ap 210..330 CDD:465438 15/60 (25%)
CIRBPNP_001287758.1 RRM_CIRBP_RBM3 6..85 CDD:409883 27/80 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.