DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and Rbm3

DIOPT Version :10

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_446148.1 Gene:Rbm3 / 114488 RGDID:620145 Length:156 Species:Rattus norvegicus


Alignment Length:161 Identity:47/161 - (29%)
Similarity:69/161 - (42%) Gaps:26/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAKVILD-SLGFSKGYGFVRFGIEDEQKSALY 159
            :..|..::||.|:.:.|:..|...||| |..|....|:.| ....|:|:||:.|...:....|:.
  Rat     2 SSEEGKLFVGGLNFNTDEQALEDHFSS-FGPISEVVVVKDRETQRSRGFGFITFTNPEHASDAMR 65

  Fly   160 DMNGYIGLGTKPIKICNAVPKPKSELGGAVG---------EGNTNYGYGSGM--TAAGGTDY--- 210
            .|||. .|..:.|::.:|....:...|||.|         .|..:.|||||.  :..||..|   
  Rat    66 AMNGE-SLDGRQIRVDHAGKSARGTRGGAFGAHGRGRSYSRGGGDQGYGSGRYDSRPGGYGYGYG 129

  Fly   211 -SQYYDPTSTYWQGYQAWQGYYEQAGASITD 240
             |:.|...|   ||     ||...:|.:..|
  Rat   130 RSRDYSGRS---QG-----GYDRYSGGNYRD 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:410022
RRM2_SECp43_like 99..178 CDD:409781 24/79 (30%)
Trnau1ap 210..330 CDD:465438 10/35 (29%)
Rbm3NP_446148.1 RRM_CIRBP_RBM3 6..85 CDD:409883 24/80 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.