DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Secp43 and HNRNPA0

DIOPT Version :9

Sequence 1:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_006796.1 Gene:HNRNPA0 / 10949 HGNCID:5030 Length:305 Species:Homo sapiens


Alignment Length:241 Identity:61/241 - (25%)
Similarity:104/241 - (43%) Gaps:28/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CQLWMGSLESYMTENFIIAAFRKMGEDPTTVRLMRNKYTGEPAGYCFVNFISDDHALDAM----H 66
            |:|::|.|....:|:.:...|...| ..|...::.|..|.....:.||.:.:.:.|..||    |
Human     7 CKLFIGGLNVQTSESGLRGHFEAFG-TLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPH 70

  Fly    67 KLNGKPIPGTNPIVRFRLNSASNSYKLPGNEREFSVWVGDLSSDVDDYQLYKVFSSKFTSIKTAK 131
            .::|      |.:...|..|..:|.:...:.:...::||.|..||.:..|.:.| |:|.:::.|:
Human    71 AVDG------NTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHF-SQFGTVEKAE 128

  Fly   132 VILD-SLGFSKGYGFVRFGIED-EQKSALYDMNGYIGLGTKPIKICNAVPK-----------PKS 183
            :|.| ..|..:|:|||.|...| ..|:|:...:...|   ..:::..||||           .:|
Human   129 IIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQG---HRVEVKKAVPKEDIYSGGGGGGSRS 190

  Fly   184 ELGGAVGEGNTNYGYGSGMTAAGGTDYSQYYDPTSTYWQGYQAWQG 229
            ..||..|.|.......:|::..||..|:.|.........||.|:.|
Human   191 SRGGRGGRGRGGGRDQNGLSKGGGGGYNSYGGYGGGGGGGYNAYGG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 19/86 (22%)
RRM2_SECp43 99..180 CDD:241056 24/82 (29%)
HNRNPA0NP_006796.1 RRM1_hnRNPA0 5..83 CDD:240772 19/82 (23%)
RRM2_hnRNPA0 99..178 CDD:241023 26/82 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..214 9/39 (23%)
HnRNPA1 255..>269 CDD:314495
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..305
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.