DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and YOL162W

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_014480.1 Gene:YOL162W / 854002 SGDID:S000005522 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:225 Identity:44/225 - (19%)
Similarity:75/225 - (33%) Gaps:61/225 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 GLLT--AGSALGTLLTGIMGSFLLDYFGW------SYVFRVIGLMGIAWALVLRYYAMAGERNRI 220
            |||.  ..:.|.|.||.::.|.....|..      ::|..::.|.|:.|:               
Yeast     2 GLLAYIPTNVLATYLTLVLRSIGFTTFQANLLAIPNFVLHILLLFGLTWS--------------- 51

  Fly   221 INIATPSRLCANK------SPAETSAVPWLRYFRRLSFWACVLTHACEMNCFFVLLSWLPTYFHD 279
                  :..|.|:      .|..|  ||.|...|   ||...:.:.........|:...| |.|.
Yeast    52 ------TEKCNNRLGLSLLQPLYT--VPLLAVLR---FWKGTMFNKWGTYAIITLILDNP-YIHA 104

  Fly   280 GFPHAKGWVVNMIPWLALPPCTLFAKYLTTRLLAREWHTTTVRK--VIQSCCFAAQNLALFVMSR 342
                           :.:..|:..::.:.||.::...:...|:.  :|.|..:|..:..|:....
Yeast   105 ---------------ICVSLCSRNSQSVKTRTVSTCLYNMFVQAGLIISSNIYAKSDAPLYRKGN 154

  Fly   343 TSDFHTALICMTIIIGGTGFHNNAVTVNPQ 372
            ...|..||....|:||....:   |.:|.|
Yeast   155 GVLFGLALFMFPILIGSKLIY---VYINKQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 44/225 (20%)
MFS_1 32..397 CDD:284993 44/225 (20%)
YOL162WNP_014480.1 MFS <1..169 CDD:421695 39/208 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344246
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.