DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and SEO1

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_009333.1 Gene:SEO1 / 851230 SGDID:S000000062 Length:593 Species:Saccharomyces cerevisiae


Alignment Length:285 Identity:66/285 - (23%)
Similarity:108/285 - (37%) Gaps:87/285 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 WSLITFLMPTIIWTAGSIKSYAIPFIVAIRILNGALQGVHFPSMISLTSQNLCPN--------ER 159
            |||:         |.|:....::|.:.|||...||.:.   ||.  |..|.|..:        .|
Yeast   214 WSLL---------TVGAAYVNSVPHLKAIRFFIGAFEA---PSY--LAYQYLFGSFYKHDEMVRR 264

  Fly   160 SSFF------GLLTAG---SALGTLLTGIMGSFLLDYFGWSYVFR-----VIGLMGIAWALVLRY 210
            |:|:      |:|:||   ||:.:.|.|:.|   |:.:.|:::..     |:||:|        :
Yeast   265 SAFYYLGQYIGILSAGGIQSAVYSSLNGVNG---LEGWRWNFIIDAIVSVVVGLIG--------F 318

  Fly   211 YAMAGERNRIINI--------ATPSRLCAN---KSPAETSAVP---WLRYFRRLSFWACVLTHAC 261
            |::.|:.....:|        ....||..|   ||..||....   |...|   |.|...:....
Yeast   319 YSLPGDPYNCYSIFLTDDEIRLARKRLKENQTGKSDFETKVFDIKLWKTIF---SDWKIYILTLW 380

  Fly   262 EMNCF-------FVLLSWLPTYFHDGFPHAKGWVVNMI-PWLALPPCTLFAKYLTTRLLAREWHT 318
            .:.|:       ...|.||.:......|...  .::|| |.|.:      ...:.|.::|.:.|:
Yeast   381 NIFCWNDSNVSSGAYLLWLKSLKRYSIPKLN--QLSMITPGLGM------VYLMLTGIIADKLHS 437

  Fly   319 -------TTVRKVIQSCCFAAQNLA 336
                   |.|..:|.:...||.::|
Yeast   438 RWFAIIFTQVFNIIGNSILAAWDVA 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 66/285 (23%)
MFS_1 32..397 CDD:284993 66/285 (23%)
SEO1NP_009333.1 MFS_FEN2_like 134..548 CDD:340885 66/285 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.