DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and PHT4;2

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001325125.1 Gene:PHT4;2 / 818384 AraportID:AT2G38060 Length:561 Species:Arabidopsis thaliana


Alignment Length:365 Identity:101/365 - (27%)
Similarity:166/365 - (45%) Gaps:19/365 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ITLITG--TCMLYSTRTTMPLLVPAVASAQKWSKTDSGTVLSSFFWGYTLTQVVGGYFSDRFGGQ 93
            :.::|.  .|:..:.|..|.:.|..:|....||.:..|.|.|||.|||..:.|:||...||:||:
plant   101 VVILTACMMCLCNADRVVMSVAVVPLADKLGWSSSFLGVVQSSFLWGYIFSSVIGGALVDRYGGK 165

  Fly    94 RVILFAAIGWSLITFLMPTIIWTAGSIKSYAIPFIVAIRILNGALQGVHFPSMISLTSQNLCPNE 158
            ||:.:....|||.|.|.|   |.|    :::...::.:|...|..:||..|||.:|.|:....:|
plant   166 RVLAWGVALWSLATLLTP---WAA----AHSTLALLCVRAFFGLAEGVAMPSMTTLLSRWFPMDE 223

  Fly   159 RSSFFGLLTAGSALGTLLTGIMGSFLLDYFGWSYVFRVIGLMGIAWALVLRYYAMAGERNRIINI 223
            |:|..|:..||..:|.::..::...:|...|.|..|.:...:|:.|............::.....
plant   224 RASAVGISMAGFHMGNVVGLLLTPLMLSSIGISGPFILFASLGLLWVSTWSSGVTNNPQDSPFIT 288

  Fly   224 ATPSRLCANKSPAETSAV-----PWLR-YFRRLSFWACVLTHACEMNCFFVLLSWLPTYFHDGFP 282
            .:..||.....|.:.|.:     |.|| ...:|..||.:..:......:||||||:|.||...|.
plant   289 RSELRLIQAGKPVQPSTISPKPNPSLRLLLSKLPTWAIIFANVTNNWGYFVLLSWMPVYFQTVFN 353

  Fly   283 ---HAKGWVVNMIPWLALPPCTLFAKYLTTRLLAREWHTTTVRKVIQSCCFAAQNLALFVMSRTS 344
               ....| .:.:||..:.....:|...:..|:......|:|||::||..|....|:|..::...
plant   354 VNLKQAAW-FSALPWATMAISGYYAGAASDFLIRTGHSVTSVRKIMQSIGFMGPGLSLLCLNFAK 417

  Fly   345 DFHTALICMTIIIGGTGFHNNAVTVNPQDLAPLHSGSVFG 384
            ....|.:.|||.:..:.|......:|.||:||.::|.:.|
plant   418 SPSCAAVFMTIALSLSSFSQAGFLLNMQDIAPQYAGFLHG 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 101/365 (28%)
MFS_1 32..397 CDD:284993 101/364 (28%)
PHT4;2NP_001325125.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53923
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11662
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.