DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and CG18788

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster


Alignment Length:423 Identity:89/423 - (21%)
Similarity:168/423 - (39%) Gaps:79/423 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VASAQKWSKTDSGTVLSSFFWGYTLTQVVGGYFSDRFGGQRVILFAAIGWSLITFLMPTIIWTAG 118
            ::.:::|.:.....|:.:|:.||.|:.|.||..::|:||:.|:..|.:..:::|.|.||.:...|
  Fly   129 LSCSEQWPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGG 193

  Fly   119 SIKSYAIPFIVAIRILNGALQGVHFPSMISLTSQNLCPNERSSFFGLLTAGSALGTLLTGIMGSF 183
               .||   :||:|:|.|..:|..||::.:|.:|.:...||......:.:|..:|..:..::...
  Fly   194 ---LYA---LVAVRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGL 252

  Fly   184 LLDYFGWSYVFRVIGLMGIAWAL---VLRY-------YAMAGERNRI-INIATPSRLCANKS--- 234
            |:....|...|.::|...:||.|   ::.|       :..:.||..| .|.:....|...:.   
  Fly   253 LIAEQDWPVFFYLVGGGAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREE 317

  Fly   235 ------------------PAETSAVPWLRYFRRLSFWACVLTHAC----------------EMNC 265
                              .|..:..||.........||.|.|...                |:..
  Fly   318 MDGEDGYEGEDREHRREVEATCNTAPWRSMLNSTPLWALVSTSMQQEFQQKLPQELQIALEEVRA 382

  Fly   266 FFVLLSWLPTYFHDGFPHAKGWVVNMIPWLALPPCTLFAKYLTTRLLAREWHTTTVRKVIQSCCF 330
            .....|.|.|......|....|:.      :|....|....:..::|.|    |..|:::....|
  Fly   383 RGTSFSELTTIIETIAPSVGNWIA------SLTTGRLSDVLIEQQILTR----TQTRRLMSWLVF 437

  Fly   331 AAQNLALFVMSRTSDFHTALICMTIIIGGTGFHNNAVTVNPQDLAPLHSGSVFGLMNTVGAIPGF 395
            ...::.:..:..:.    |.|...:   |.|.:..::.:.|.|::|.::|::.|:...:||:|..
  Fly   438 LCGSMYMLQIKMSG----ARIWSVL---GMGAYYASIKLLPLDMSPNYAGTLMGISGGMGALPAL 495

  Fly   396 LGVYLAGHILELTQSWPMVFSAAAGINLVGWII 428
            |..||.    :|...:.:|.|..|.:    |:|
  Fly   496 LMPYLE----QLETDYKLVSSVRAAM----WVI 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 89/423 (21%)
MFS_1 32..397 CDD:284993 80/390 (21%)
CG18788NP_652665.3 MFS 129..>280 CDD:119392 42/156 (27%)
MFS_1 135..498 CDD:284993 81/385 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.