DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and MFS9

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_650889.1 Gene:MFS9 / 42426 FlyBaseID:FBgn0038799 Length:502 Species:Drosophila melanogaster


Alignment Length:462 Identity:123/462 - (26%)
Similarity:213/462 - (46%) Gaps:57/462 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ELVDTQSI-WTRHEKRVWFITLIT--GTCMLYSTRTTMPLLVPAV------------ASAQK--- 59
            |:.:::.: |....|:.:.:.|:.  |...:||.|..:.:.:.|:            .|.|:   
  Fly    22 EITESEPLTWRFWRKQRYIVVLLAFFGFFNVYSLRVNLSVAIVAMTENRTVFDADGNVSYQQDFP 86

  Fly    60 WSKTDSGTVLSSFFWGYTLTQVVGGYFSDRFGGQRVILFAAIG-WSLITFLMPTIIWTAGSIKSY 123
            |.....|.:|||||:||.|||.:|||...:.|| .::....|| .:::|.|.|       ...|:
  Fly    87 WDSKQKGLILSSFFYGYILTQFLGGYIGTKIGG-NIVFGTGIGSTAILTLLTP-------MAASH 143

  Fly   124 AIPFIVAIRILNGALQGVHFPSMISLTSQNLCPNERSSFFGLLTAGSALGTLLTGIMGSFLLDYF 188
            ::...:.:||:.|..:||.||.:.::.::...|.|||....:..||:..||::......||...:
  Fly   144 SLEMFLFVRIIEGFFEGVTFPGIHAVWARWSPPLERSRMASIAFAGNYAGTVVAMPCSGFLATKY 208

  Fly   189 GWSYVFRVIGLMGIAWALVLRYYAMAGERNRIINIATPSRLCANKSPAETSAV------------ 241
            ||..||.|.|.:|:.|.:....:..||..        ..|.|   |..|...:            
  Fly   209 GWESVFYVFGTIGVIWYITWLVFVKAGPE--------LDRFC---SKEECDYIQKTIGYVGSKHV 262

  Fly   242 --PWLRYFRRLSFWACVLTHACEMNCFFVLLSWLPTYFHD--GFPHAKGWVVNMIPWLALPPCTL 302
              ||...|..:.|:|.:.:|..|...|:.||:.||::..|  .|...|..:::.:|:||:.....
  Fly   263 KHPWRAIFTSMPFYAIMASHFSENWGFYTLLTQLPSFLRDTLNFDLGKTGILSAVPYLAMGILLA 327

  Fly   303 FAKYLTTRLLARE-WHTTTVRKVIQSCCFAAQNLALFVMSRTSDFHTALICMTIIIGGTGFHNNA 366
            .:.||...|..:. |.||.||:......|.||.:.:.:.:...|...:::.:||.:|...|..:.
  Fly   328 VSGYLADWLQVKGIWTTTQVRRNFNCGAFLAQTVFMMLTAYLLDPTWSVVSLTIAVGLGAFAWSG 392

  Fly   367 VTVNPQDLAPLHSGSVFGLMNTVGAIPGFLGVYLAGHIL--ELTQSWPMVFSAAAGINLVGWIIF 429
            ..||..|:||.|:..:.|:.||...|||.:...|.|:::  :.:..|.::|..:|||.|||.:|:
  Fly   393 FAVNHLDIAPQHASVLMGIGNTFATIPGIVSPLLTGYVVTNQTSDEWRIIFFISAGIYLVGCVIY 457

  Fly   430 IVFGSAE 436
            ..:.|.:
  Fly   458 WFYCSGD 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 119/438 (27%)
MFS_1 32..397 CDD:284993 108/399 (27%)
MFS9NP_650889.1 2A0114euk 38..477 CDD:129972 120/446 (27%)
MFS 42..460 CDD:119392 119/436 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.