DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and CG9826

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_611724.1 Gene:CG9826 / 37625 FlyBaseID:FBgn0034784 Length:495 Species:Drosophila melanogaster


Alignment Length:449 Identity:119/449 - (26%)
Similarity:195/449 - (43%) Gaps:70/449 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LITGTCMLYSTRTTMPLLVPAVASAQ---------KWSKTDSGTVLSSFFWGYTLTQVVGGYFSD 88
            |..|..:::..|..:.:.:.|:.:|.         :|::.....:||||:|||.||...|.:...
  Fly    21 LFLGLTVMHIARLNVSVAIVAMTNAATTNPNFPEFEWTEKQKSYILSSFYWGYILTLFPGSFLCR 85

  Fly    89 RFGGQRVILFAAIGWSLITFLMP-TIIWTAGSIKSYAIPFIVAIRILNGALQGVHFPSMISLTSQ 152
            |:|.:.|:..|:.|.::::.:.| .|.|....:       ..|||||.|..|||.||.:....:.
  Fly    86 RYGAKVVLFVASCGTAVLSLMTPWCITWGGWQV-------FCAIRILQGLFQGVIFPCVTEHLAM 143

  Fly   153 NLCPNERSSFFGLLTAGSALGTLLT-GIMGSFLLDYFGWSYVFRVIGLMGIAWALVLRYYAMAGE 216
            ...|.||:........|:..||:|. .|.|.......||..:..|.|.:..||..:...:|.   
  Fly   144 WSPPEERNRLGAFSYTGTDCGTVLAMFISGMIAKGAMGWPGISYVSGSLCAAWCFLWLIFAS--- 205

  Fly   217 RNRIINIATPSRLCAN------KSPAE--------TSAVPWLRYFRRLSFWACVLTHACEMNCFF 267
                 |.||.||....      :|..|        |..:||...:..:.|.|.::|...|.....
  Fly   206 -----NNATESRFVGEAECKYIESSLEHNEDFHGRTIPIPWRAIWTSVPFLALLVTRCAETYGLS 265

  Fly   268 VLLSWLPTYFHDGFPHAKGWVVNM----------IPWLALPPCTLFAKYLTTR--LLARE-WHTT 319
            .|.:.:|:|.:.        |:||          :|:||:  ..|...||...  ||.:: ...|
  Fly   266 TLQAEIPSYMNG--------VLNMEIQSNAVFSSLPFLAM--WLLSYVYLIAADVLLKKKILSLT 320

  Fly   320 TVRKVIQSCCF---AAQNLALFVMSRTSDFHTALICMTIIIGGTGFHNNAVTVNPQDLAPLHSGS 381
            .|||:..:..|   ||..:.:..:|..:. :.|::.||:.:|.........::|..||:|.|:|.
  Fly   321 AVRKLFNTLSFWIPAAALIGIGFLSEENK-NLAIVLMTVSVGVNSGATIGSSLNSIDLSPNHAGI 384

  Fly   382 VFGLMNTVGAIPGFLGVYLAGHILELTQS---WPMVFSAAAGINLVGWIIFIVFGSAEA 437
            :.||.|||..:...|...:||.|:....:   |.:||..||.|..||.::||::|:|:|
  Fly   385 LIGLSNTVANVIPILTPLIAGEIVADKHNRGQWQIVFGLAAVIFFVGNVVFIIWGTAKA 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 116/442 (26%)
MFS_1 32..397 CDD:284993 102/404 (25%)
CG9826NP_611724.1 2A0114euk 14..450 CDD:129972 119/449 (27%)
MFS 19..438 CDD:119392 116/442 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452000
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.