DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and CG9825

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_611723.3 Gene:CG9825 / 37624 FlyBaseID:FBgn0034783 Length:485 Species:Drosophila melanogaster


Alignment Length:465 Identity:120/465 - (25%)
Similarity:188/465 - (40%) Gaps:87/465 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RHEKRVWFITLITGTCMLYSTRTTMPLLVPAVASAQ---------KWSKTDSGTVLSSFFWGYTL 78
            ||.:.:.....||   .::..|..:.:.|.|:.:|:         .|::.:...:||||||||.|
  Fly    14 RHVQALLIFLNIT---TVFIGRLNVGVSVVAMTNAETTNPNFPEYDWTEAEKSYILSSFFWGYIL 75

  Fly    79 TQVVGGYFSDRFGGQRVILFAAIGWSLITFLMPTII----WTAGSIKSYAIPFIVAIRILNGALQ 139
            ||.:|||...|||.:.|:.:...|..:.:.|.|..|    |.|          ...||:|.|..|
  Fly    76 TQFLGGYLCKRFGVKSVMFWGVFGSGVCSALTPLFIGFGEWQA----------YCGIRVLMGLAQ 130

  Fly   140 GVHFPSMISLTSQNLCPNERSSFFGL----LTAGSALGTLLTGIMGSFLLDYFGWSYVFRVIGLM 200
            ||.||.:....::...|.||:....|    :..|:.....|:|::....|.:.|.|||     ..
  Fly   131 GVVFPCIHQHLAKWSPPEERNRLGALSHTGIECGNVSAMFLSGMIAKSSLGWPGISYV-----SA 190

  Fly   201 GIAWALVLRYYAMA----------GERNRIINIATPSRLCANKS-PAETSAVPWLRYFRRLSFWA 254
            |:|:.....::..|          || |.:|.|  .|.|..|:| .|....:||...:....|.|
  Fly   191 GVAFFWCTLWFVFAANHPTESRFIGE-NELIYI--ESSLKHNESYHATIIPIPWKAIWTSAPFLA 252

  Fly   255 CVLTHACEMNCFFVLLSWLPTY-------------FHDGFPHAKGWVVNMIPWLALPPCTLFAKY 306
            .::....|......|.:.:|:|             |....|....|.::.|             |
  Fly   253 LLIVRCAENWGLSTLQAEIPSYMNGVLDMDMKSNAFFSALPFLAMWCMSYI-------------Y 304

  Fly   307 LTTR--LLAREWHTTTV-RKVIQSCCF---AAQNLAL-FVMSRTSDFHTALICMTIIIGGTGFHN 364
            |...  ||.:...:.|: ||...|..|   ||..:.: |:.....:|..||  |||.:|......
  Fly   305 LVVADVLLGKNSVSLTILRKTYNSIAFWIPAATLVGIGFLDKEQKNFAIAL--MTISVGVNSAQT 367

  Fly   365 NAVTVNPQDLAPLHSGSVFGLMNTVGAIPGFLGVYLAGHILELT---QSWPMVFSAAAGINLVGW 426
            ....:|..||:..|:..:.|::||.......:...:.|.|::..   ..|.:||..|:.|..||.
  Fly   368 IGSVLNTIDLSKNHASILMGIVNTAANFVPIVTPLVVGWIVKENSDRSQWQIVFIIASVIFFVGN 432

  Fly   427 IIFIVFGSAE 436
            .|::|||:||
  Fly   433 CIYLVFGTAE 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 113/452 (25%)
MFS_1 32..397 CDD:284993 103/412 (25%)
CG9825NP_611723.3 2A0114euk 14..450 CDD:129972 120/465 (26%)
MFS 54..438 CDD:119392 107/416 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452001
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.