DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and Picot

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_725600.1 Gene:Picot / 36865 FlyBaseID:FBgn0024315 Length:529 Species:Drosophila melanogaster


Alignment Length:475 Identity:115/475 - (24%)
Similarity:198/475 - (41%) Gaps:93/475 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 WFIT--LITGTCMLYSTRTTMPLLVPAVAS--------AQK---------------------WSK 62
            :|:|  |..|....|..||.|.:.:.|:.:        |::                     ||.
  Fly    41 YFVTFMLFLGMANAYVMRTNMSVAIVAMVNHTAIKSGEAEEYDDECGDRDIPIDDSQDGEFAWSS 105

  Fly    63 TDSGTVLSSFFWGYTLTQVVGGYFSDRFGGQRVILFAAIGWSLITFLMPTI-----IWTAGSIKS 122
            ...|.:|||||:||.:||:..|..:.::|..|.:.:..:..|:..||:|..     :|.      
  Fly   106 ALQGYILSSFFYGYVITQIPFGILAKKYGSLRFLGYGMLINSVFAFLVPVAARGGGVWG------ 164

  Fly   123 YAIPFIVAIRILNGALQGVHFPSMISLTSQNLCPNERSSFFGLLTAGSALGTLLTGIMGSFLLDY 187
                 :.|:|.:.|..:|...|...::.::.:.|||||.....:.||:..||:::..:...|.:|
  Fly   165 -----LCAVRFIQGLGEGPIVPCTHAMLAKWIPPNERSRMGAAVYAGAQFGTIISMPLSGLLAEY 224

  Fly   188 ---FGWSYVFRVIGLMGIAWALVLRYYA--------MAGER-NRIINIATPSRLCAN---KSPAE 237
               .||..:|.|.|::|..|::....:.        ...|| .:.||    ..|...   |||  
  Fly   225 GFDGGWPSIFYVFGIVGTVWSIAFLIFVHEDPSSHPTIDEREKKYIN----DSLWGTDVVKSP-- 283

  Fly   238 TSAVPWLRYFRRLSFWACVLTHACEMNCFFVLLSWLPTYFHD--GFPHAKGWVVNMIPWLALPPC 300
              .:|:....:.|.|:|.:..|......:..|::.||||...  .|......:::.:|:||:   
  Fly   284 --PIPFKAIIKSLPFYAILFAHMGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSLPYLAM--- 343

  Fly   301 TLFAKYLTTRLLAREW--------HTTTVRKVIQSCCFAAQNLALFVMSRTS-DFHTALICMTII 356
            .||:.:::   :..:|        ||.| ||:|.|.......:||...|.|. |....|..:||.
  Fly   344 WLFSMFIS---VVADWMISSKRFSHTAT-RKLINSIGQYGPGVALIAASYTGCDRALTLAILTIG 404

  Fly   357 IGGTGFHNNAVTVNPQDLAPLHSGSVFGLMNTVGAIPGFLGVYLAGHILE-----LTQSWPMVFS 416
            :|..|...:...:|..||.|..:|.:..:.|....:.|.|....|||::.     :...|.:||.
  Fly   405 VGLNGGIYSGFKINHLDLTPRFAGFLMSITNCSANLAGLLAPIAAGHLISDPSKPMMGQWQIVFF 469

  Fly   417 AAAGINLVGWIIFIVFGSAE 436
            .||.:.::....:.:|||.|
  Fly   470 IAAFVYIICGTFYNIFGSGE 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 111/468 (24%)
MFS_1 32..397 CDD:284993 101/426 (24%)
PicotNP_725600.1 2A0114euk 41..501 CDD:129972 115/475 (24%)
MFS 100..485 CDD:119392 101/410 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452021
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.