DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and NaPi-T

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001260981.1 Gene:NaPi-T / 36651 FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster


Alignment Length:420 Identity:100/420 - (23%)
Similarity:180/420 - (42%) Gaps:65/420 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VPAVASAQKWSKTDSGTVLSSFFWGYTLTQVVGGYFSDRFGGQRVILFAAIGWS-----LITFLM 110
            :|...:...|::...|.:|.||||.:...|:.||..:.::|.:.|     .|||     ...||:
  Fly    76 IPYEKNGFHWNEKQQGALLGSFFWAHWTLQIPGGILATKYGTKLV-----FGWSNGIGVFCCFLI 135

  Fly   111 PTIIWTAGSIKSYAIPFIVAIRILNGALQGVHFPSMISLTSQNLCPNERSSFFGLLTAGSALGTL 175
            |.:     |..||.  .::.:|:..|.:.|:.:|||..||::.:.|||||.|.... .||::|..
  Fly   136 PIV-----SYWSYT--GLIILRVFQGWITGLAWPSMHVLTAKWIPPNERSKFVSAY-LGSSVGVA 192

  Fly   176 LTGIMGSFLLDYFGWSYVFRVIGLMGIAWALVLRYYA---------MAGERNRIINIATPSRLCA 231
            |...:..:::|:..|.:|:.:.|::|..|.:..::..         :|....:.|..:..:.:..
  Fly   193 LFYPIFGYIIDWTRWEWVYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFIEKSLGASIQG 257

  Fly   232 NKSPAETSAVPWLRYFRRLSFWACVLTHACEMNCFFVLLSWLPTYFH-------------DGFPH 283
            :|.|     .||.........|..|:.....:...|.|::..||||.             .|.||
  Fly   258 SKGP-----TPWKAIATSRPVWLNVVAQWGGIWGLFTLMTHAPTYFRLIHHWNIRATGFLSGLPH 317

  Fly   284 AKGWVVNMIPWLALPPCTLFAKYLTTRLLAREWHTTTVRKVIQSCCFAAQNLALFVMSRTSDFHT 348
                   ::..|.....::||.||   |...:...|.|||:....|...:.|.:..::......|
  Fly   318 -------LMRMLFAYVFSIFADYL---LRTDKMSRTNVRKLATFICCGTKGLIVLALAYFGYNAT 372

  Fly   349 ALICMTIIIGGTGFHNNAVTVNP----QDLAPLHSGSVFGLMNTVGAIPGFLGVYLAGHILELTQ 409
            |.|.:..:  .|..| .||:..|    .||:|.::|.|.|:...:|.:|||:..::.|.:....|
  Fly   373 AAIVLVTV--ATMLH-GAVSSGPLASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHNNQ 434

  Fly   410 ---SWPMVFSAAAGINLVGWIIFIVFGSAE 436
               :|..||...:.:.....|::::|..::
  Fly   435 TIDAWKNVFLLTSLMLTGSGILYVLFSESK 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 99/414 (24%)
MFS_1 32..397 CDD:284993 93/376 (25%)
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 100/420 (24%)
MFS 76..460 CDD:119392 99/414 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.