DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and CG7881

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001286144.1 Gene:CG7881 / 35521 FlyBaseID:FBgn0033048 Length:482 Species:Drosophila melanogaster


Alignment Length:468 Identity:107/468 - (22%)
Similarity:202/468 - (43%) Gaps:87/468 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IWTRH-EKRVWFITLITGTCMLYSTRTTMPLLVPAVASA---------QKWSKTDSGTVLSSFFW 74
            |..|| :..:.|:.::..    |:.|.::.:.:.|:..|         ..|:......:||||:|
  Fly    10 IGIRHMQALLLFLAIVVN----YTARLSVSVAIVAMTDAATTNLDFPEYNWNGVQQSYILSSFYW 70

  Fly    75 GYTLTQVVGGYFSDRFGGQRVILFAAIGWSLITFLMP-TIIWTAGSIKSYAIPFIVAIRILNGAL 138
            ||.:||...|:...|||.:.|:|...:..::::.|.| .:.|  |..:::.     .|||:.|..
  Fly    71 GYIVTQFPAGFLVRRFGAKAVLLVPTLATAVLSGLTPYCVAW--GGWQAFC-----TIRIVEGLF 128

  Fly   139 QGVHFPSMISLTSQNLCPNERSSFFGLLTAGSALGTLL----TGIM--GSFLLDYFGWSYVFRV- 196
            ||:.||.:....::...|.:|:.......:|:..|::|    :|::  ||     .||..:|.| 
  Fly   129 QGLIFPCIHEHLAKWSPPEDRNRLGAFAYSGADCGSVLAMASSGLIANGS-----MGWPGIFYVS 188

  Fly   197 IGLMGIAWALVLRYYAMAGERNRIINIATPSRLCANKS--------------PAETSAVPWLRYF 247
            .|..|: |.|:   :.:.|..|     |..|||..::.              .|:...:||...:
  Fly   189 AGTCGL-WCLL---WVLFGANN-----APSSRLIGSREREHIERSMKRQDGFHAQKIPIPWRAIW 244

  Fly   248 RRLSFWACVLTHACEMNCFFVLLSWLPTYFHDGFPHAKGWVVNM----------IPWLALPPCTL 302
            ....|:|.::..:.:......:....|:|.|.        |:.|          :|:||:...:.
  Fly   245 SSSPFYALLVVRSAQGWANSTMQLQTPSYMHG--------VLEMDIKSNALYSALPFLAMWGMSY 301

  Fly   303 FAKYLTTRLLAREWHT-TTVRKVIQSCCFAAQNLALFVMSRTSDFHT--ALICMTIIIG---GTG 361
            .........::|:|.: ||:||.|.:..:.....||..:.......|  |:..|||..|   |:|
  Fly   302 VYLVFADVAMSRQWMSLTTLRKSINTVSYWGPAAALIGIGFLDKSQTTLAIALMTINAGLNAGSG 366

  Fly   362 FHNNAVTVNPQDLAPLHSGSVFGLMNTVGAIPGFLGVYLAGHILELTQS---WPMVFSAAAGINL 423
            ..:....:   |::|.|||.:..::|.:|.|...|...|.|.|:..:.|   |.:||:..|.:..
  Fly   367 IGSILTII---DMSPNHSGMLMAIVNGIGNIFPLLTPLLVGVIVTESDSRSQWQIVFAMTAVVFF 428

  Fly   424 VGWIIFIVFGSAE 436
            :|.::::::|:.:
  Fly   429 IGNLVYLIWGTTD 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 103/451 (23%)
MFS_1 32..397 CDD:284993 92/411 (22%)
CG7881NP_001286144.1 2A0114euk 12..449 CDD:129972 106/466 (23%)
MFS 18..437 CDD:119392 103/454 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451995
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.