DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and CG3036

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001260058.1 Gene:CG3036 / 33695 FlyBaseID:FBgn0031645 Length:493 Species:Drosophila melanogaster


Alignment Length:467 Identity:114/467 - (24%)
Similarity:199/467 - (42%) Gaps:84/467 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ITLIT--GTCMLYSTRTTMPLLV-----PAVASAQK---------------------------WS 61
            :.|:|  |..:.|:.|..:.:.:     |.|.||..                           |.
  Fly    22 LNLLTMLGFMLNYALRVNLTIAIVDMVRPNVTSAVNATLVGNSTAANSTASPDGVDVYEERFPWD 86

  Fly    62 KTDSGTVLSSFFWGYTLTQVVGGYFSDRFGGQRVILFAAIGWSLITFLMPTIIWTAGSIKSYAIP 126
            ...:..||..|||||.||::.||..::..||:||...:.:..||:|.:.|    .|..| :|.: 
  Fly    87 SYQTNFVLGCFFWGYILTELPGGRLAELIGGRRVFGHSMLWASLLTLITP----LAAHI-NYVV- 145

  Fly   127 FIVAIRILNGALQGVHFPSMISLTSQNLCPNERSSFFGLLTAGSALGTLLTGIMGSFLLDYFGWS 191
             ::.:|::.|.:.|..:|::..:.:..:.|.|||.|...:.| |:||..:|..:..:|:...||:
  Fly   146 -LIVVRVVLGFMLGASWPAIHPVAAVWIPPMERSKFMSNMMA-SSLGAAITMPICGYLISVAGWA 208

  Fly   192 YVFRVIGLMGIAWALVLRYYAMAGERNRIINIATPSRLCANK------------SPAETSAVPWL 244
            .||.:.|.:|:.|:|.  ::....|     ..||..|:.|.:            |....|.|||.
  Fly   209 SVFYLTGAVGLLWSLA--WFTFVYE-----TPATHPRISAEERREIEEAIGTTTSKKRPSHVPWG 266

  Fly   245 RYFRRLSFWACVLTHACEMNCFFVLLSWLPTY----FHDGFPHAKGWVVNMIPWLALPPCTLFAK 305
            :.....:.||.::.|...:..||.:::.|||:    .|  |...:..:.:.:|:|......:.:.
  Fly   267 QLLCSPAVWAIIICHGLAVFGFFTVVNQLPTFMSKILH--FDIKQNGLFSSLPYLGKYVMAVASS 329

  Fly   306 YLTTRLLAR-EWHTTTVRKVIQSCCFAAQNLALFV---MSRTSDFHTALICMTIIIGGTGFHNNA 366
            ||...|..: ...||..||:..:.......|.:.|   :...:.:...:..:.:      |.:.|
  Fly   330 YLADYLRKKGTLSTTATRKLFTTFALVIPGLLMIVQVFLGYDATWSVTIFSLAL------FAHGA 388

  Fly   367 VTV----NPQDLAPLHSGSVFGLMNTVGAIPGFLGVYLAGHILELTQ---SWPMVFSAAAGINLV 424
            ||.    |..|:||...|::|||.||:.:..|||...:.|.:....|   ||.:||...|...:.
  Fly   389 VTAGYLGNGLDIAPNFGGTIFGLANTLSSFGGFLSTSMVGALTYKDQSFHSWQIVFWILAATYIS 453

  Fly   425 GWIIFIVFGSAE 436
            ..::|.:.||.|
  Fly   454 AAVVFAILGSGE 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 111/461 (24%)
MFS_1 32..397 CDD:284993 102/422 (24%)
CG3036NP_001260058.1 2A0114euk 19..477 CDD:129972 114/467 (24%)
MFS 83..461 CDD:119392 102/400 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.