DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and MFS17

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001015096.2 Gene:MFS17 / 3354861 FlyBaseID:FBgn0058263 Length:505 Species:Drosophila melanogaster


Alignment Length:499 Identity:118/499 - (23%)
Similarity:214/499 - (42%) Gaps:94/499 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DEKLKYSLLRGELV------DTQSIWTRHE---KRVWFITLITGTCMLYSTRTTMPL-LVPAVA- 55
            :.::.||..:.:::      :|||...|.:   :.|.:....:|..:.:..|..|.. ||..:| 
  Fly     3 NSRVSYSSPQDDVLTGRDGRETQSSLLRDKIPARLVLYFLSWSGFLVSFMMRNDMNFALVAMIAN 67

  Fly    56 --SAQKWSKTDS------GT----------VLSSFFWGYTLTQVVGGYFSDRFGGQRVILFAAIG 102
              |.|..|...|      ||          |:|||:|.|.|:|||||..::.||.:.|..::.:.
  Fly    68 DNSTQNQSLIKSQQILGTGTDDQKTIVKSVVISSFYWCYVLSQVVGGVATELFGTKCVFGWSQLA 132

  Fly   103 WSLITFLMPTIIWTAGSIKSYAIPFIVAIRILNGALQGVHFPSMISLTSQNLCPNERSSFFGLLT 167
            .:|.:|:||    :|..:...|   ::.:|.:.|...|:.:|:|.::....:...|||.|.... 
  Fly   133 TALCSFMMP----SAAQLHYIA---VIVLRSIQGFASGLTWPAMYAIVGYWIPLTERSRFMSSF- 189

  Fly   168 AGSALGTLLTGIMGSFLLDYFGWSYVFRVIGLMGIAWALVLRYYAMA------------GERNRI 220
            .|.::|..||..:..|:|..:||.|:|...|.:|:.|.::  :|.:|            .|.|.|
  Fly   190 QGFSIGIGLTYPLCGFILSEWGWPYIFYTTGTLGLGWCIL--WYLLAFNTPREHPRITKDELNYI 252

  Fly   221 -INIATPSRLCANKSPAETSA---VPWLRYFRRLSFWACVLTHACEMNCFFVLLSWLPTY----- 276
             :|:         |....:|.   ||||:.|:.:..||..:|....:...::.:...||:     
  Fly   253 ELNV---------KKEVNSSVKVKVPWLQIFKSIPAWAIAITTFGRIFVHYIFIVNGPTFMGNVL 308

  Fly   277 --------FHDGFPHAKGWVVNMIPWLALPPCTLFAKYLTTRLLAREWHTTTVRKVIQSCCFAAQ 333
                    |..|.|....::.:::      .|.:..|.:..::|.    .|.||||..:......
  Fly   309 KFNFETNGFLSGVPFICSYISSVL------FCYIADKIVFYKVLC----LTNVRKVFTALSQIIP 363

  Fly   334 NLALFVMSRTSDFHTAL-ICMTIIIGGTGFHNNAVTVNPQDLAPL--HSGSVFGLMNTVGAIPGF 395
            .:.::.:....:.:..| :....:|..|..:..|: .|..||||.  ||.:|.....|:.....|
  Fly   364 GVLIYCIGYIDNVYILLTVWFIAVIFITASYAGAM-ANIIDLAPNYGHSAAVLAFCQTIHMSASF 427

  Fly   396 LGVYLAGHILELTQS---WPMVFSAAAGINLVGWIIFIVFGSAE 436
            :....||.|:....|   |..||..:|.|:::.::.:.:||:||
  Fly   428 ISPLTAGFIVTQEDSIDQWRRVFEVSAIISILTYLFYQLFGTAE 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 107/456 (23%)
MFS_1 32..397 CDD:284993 98/416 (24%)
MFS17NP_001015096.2 2A0114euk 34..477 CDD:129972 112/468 (24%)
MFS 41..467 CDD:119392 107/455 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.