DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and MFS3

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_608572.1 Gene:MFS3 / 33292 FlyBaseID:FBgn0031307 Length:512 Species:Drosophila melanogaster


Alignment Length:400 Identity:99/400 - (24%)
Similarity:178/400 - (44%) Gaps:45/400 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WSKTDSGTVLSSFFWGYTLTQVVGGYFSDRFGGQRVILFAAIGWSLITFLMP--TIIWTAGSIKS 122
            ||:...||:||.:||||.::|:...:.::.|..:.|:||:.....:.|.|.|  |.:...|    
  Fly   102 WSEPLQGTLLSCYFWGYLVSQIPLAHVAENFSAKWVMLFSVAINVVCTLLTPVFTELHYGG---- 162

  Fly   123 YAIPFIVAIRILNGALQGVHFPSMISLTSQNLCPNERSSFFGLLTAGSALGTLLTGIMGSFLLDY 187
                 ::.:|:|.|...|..||:|..:.:....|.||.....::..|::.||.|:.::.......
  Fly   163 -----LILMRVLEGVGGGASFPAMHVMIASWAPPTERMVMSTIIYVGTSAGTALSILLAGVCSAQ 222

  Fly   188 FGWSYVFRVIGLMGIAWALV-----------LRYYAMAGERNRIINIATPSRLCANKSPAETSAV 241
            :||..||.|:|.:...|.|:           .|:.::. ||..|     .|.|...:......||
  Fly   223 WGWESVFYVMGALSCIWMLLWVILVQDNPNKQRFISLE-ERQMI-----TSSLGTEQKTEHHPAV 281

  Fly   242 PWLRYFRRLSFWACVLTHACEMNCFFVLLSWLPTYFHD--GFPHAKGWVVNMIPWLALPPCTLFA 304
            ||.:.|..:.|||.::.|.|....:::.|..:|.|...  .|..|....::.:|:..:...::..
  Fly   282 PWGKVFTSVPFWAILIAHTCSNFGWYMFLIEIPFYMKQVLKFNVASNAALSALPYFPMIIFSICL 346

  Fly   305 KYLTTRLLAREWHTTTV-RKVIQSCCFAAQNLALFVMSRTSDFH---TALICMTIIIGG---TGF 362
            ..|...|.|:...|||| ||...|.|.....:.|.|:......|   .:::.:.|:..|   :||
  Fly   347 GKLLDSLQAKGKITTTVARKTATSICTLIPGVCLLVLCYIGCRHYEAVSVMSVGIVAMGSMFSGF 411

  Fly   363 HNNAVTVNPQDLAPLHSGSVFGLMNTVGAIPGFLGVYLAGHILELTQ---SWPMVFSAAAGINLV 424
            .:|.:     |:||..:|::..|.||...:||.:.....|.:.:..|   :|.::|.....:..:
  Fly   412 LSNHI-----DIAPNFAGTLVALTNTAATLPGIVVPLFVGFVTKGNQNIGAWRIIFGVTIVLFAL 471

  Fly   425 GWIIFIVFGS 434
            .:::|:..||
  Fly   472 EFLVFVFLGS 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 97/396 (24%)
MFS_1 32..397 CDD:284993 92/358 (26%)
MFS3NP_608572.1 2A0114euk 19..489 CDD:129972 98/399 (25%)
MFS 100..479 CDD:119392 97/396 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.