DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and SPAC1002.16c

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_593504.1 Gene:SPAC1002.16c / 2543262 PomBaseID:SPAC1002.16c Length:499 Species:Schizosaccharomyces pombe


Alignment Length:421 Identity:79/421 - (18%)
Similarity:145/421 - (34%) Gaps:116/421 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VWFITLITGTCMLYSTRTTMPLLVPAVASAQKWSKTDSGTVLSSFFWGYTLTQVVGGYFSDRFGG 92
            |:::|.|     |:...||:.:           .|.....:|:.....|:||.:..| |...|||
pombe   102 VFYVTFI-----LFEMPTTLLM-----------KKVQPKRMLAFIVISYSLTTIFTG-FCHNFGG 149

  Fly    93 ---QRVIL-FAAIGWSLITFLMPTIIWTAGSIKSYAIPFIVAIRILNGALQGVHFPSMISLTSQN 153
               .|::| |...|......|..|:|::...: :..|.::.|...|:||                
pombe   150 LLAARLVLGFCEAGLFPCLALYLTMIYSRVEL-APRIAYLFASSALSGA---------------- 197

  Fly   154 LCPNERSSFFGLLTAGSALGTLLTGIMGSFLLDYFGWSYVFRVIGLMGI---------------- 202
                     ||.|.|.:.|.  :.|:.|     :.||.::|.:.||:|.                
pombe   198 ---------FGGLFAYAVLH--MDGVGG-----FAGWRWLFIIEGLIGFVCGVAVYFIIPNDITK 246

  Fly   203 AWALVLRYYAMAGERNRIINIATPSRLCANKSPAETSAVPW---LRYFRRLSFWACVLTHACEMN 264
            ||.|...:..|..:|.           ....:..|.:...|   ...|.....:...|:...:..
pombe   247 AWFLSKTHQEMMRKRQ-----------LERAADLEAAHFDWKGVKSAFTDFKVYLYALSEFGQDT 300

  Fly   265 CFFVLLSWLPTYFHDGFPHAKGWVVNMIPWLALPPCTL-FAKYLTTRLLAREWHTTTVRKVIQS- 327
            |.:...::||...     ...|:....:.::.:|...| .|.|:....|:..:|...:..:|.: 
pombe   301 CLYGFSTFLPAII-----SGMGYTSLSVQYMTIPVYILGAATYIAASFLSDRFHHRGIILIIGNI 360

  Fly   328 -------CCFAAQNLALFVMSRTSDFHTALICMTIIIGGTGFHNNAVTVNPQDLAPLHSGSV--- 382
                   ...|.||      :::..:....:|...:..|.|.:   ||....::||.:..:.   
pombe   361 FPIVGYILLLACQN------NKSVLYFACYLCSVGVYTGAGLN---VTWLSANIAPHYKRATAIS 416

  Fly   383 --FGLMNTVGAIPG----FLGVYLAGHILEL 407
              ..:.|:.|.:.|    :...|:|||:..|
pombe   417 LQLAIANSSGILAGQIYRYPPKYIAGHLTSL 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 78/419 (19%)
MFS_1 32..397 CDD:284993 73/405 (18%)
SPAC1002.16cNP_593504.1 MFS 63..455 CDD:119392 79/421 (19%)
2A0114 65..435 CDD:273326 74/407 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.