DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and SPAC11D3.18c

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001342807.1 Gene:SPAC11D3.18c / 2543005 PomBaseID:SPAC11D3.18c Length:498 Species:Schizosaccharomyces pombe


Alignment Length:389 Identity:77/389 - (19%)
Similarity:130/389 - (33%) Gaps:132/389 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LSSFFWGYTLTQVVGGYFSDRFGGQRVILFAAIGWSLITFLMPTIIWTAGSIKSYAIPFIVAIRI 133
            :|.|:..|.|.:........|....|::.|.:..||:      |::: :|.:.||.  .::|.|:
pombe   102 VSIFYVLYILVETPSVVLVKRIKASRMLAFISFAWSM------TVLF-SGFMSSYG--GLIATRL 157

  Fly   134 LNGALQGVHFPSMISLTSQNLCPNERSSFFGLLTAGSALGTLLTGIMGSFLLDYF------GWSY 192
            :.|.|:|..||::....:.:....|:......|.|.:.|.....|:. ::.|:..      ||.:
pombe   158 ILGLLEGCLFPALNLYLTTHYTRKEQCQRLSYLFASAGLAGAFGGLF-AYALEQVHAGNKEGWQW 221

  Fly   193 VFRVIGLMGIAWALVLRYYAMAGERNRIINIATPSRLCANKSPAETSAVPWLRYFRRLSFWACVL 257
            ::.|.||:..                    |..|..|.|.....|.:   |.            |
pombe   222 IYIVEGLVSF--------------------IGVPLCLFALPDKMENA---WF------------L 251

  Fly   258 THACEMNCFFVLLSWLPTYFHDGFPHAKGWVVNMIPWLALPPCTLFAKYLTTRLLAREWHTTTVR 322
            |.  |.....::...:...:| |..|.                              ||  :.||
pombe   252 TR--EEREVAIIRRDINARYH-GEQHF------------------------------EW--SEVR 281

  Fly   323 KVIQSCCFAAQNLALFVMSRTSDFHTALIC------MTIIIGGTGFHNNAVTVNPQDLAPLHSGS 381
            |       |.::..::| |.||.|...::.      :.:||.|.||                   
pombe   282 K-------AFKDPKVYV-SATSQFCADMVLYGFSSFLPVIIKGLGF------------------- 319

  Fly   382 VFGLMNTVGAIPGFLGVYLAGHILELTQSW--------PMVFSAAAGINLVGWIIFIVFGSAEA 437
             .||......||    ||:||.|..|..:|        .:...:|:.:..||:||.:...|..|
pombe   320 -VGLQTNYMTIP----VYIAGVISFLFVAWLSDRTQLRAVYLISASTVVAVGYIIMLASDSNAA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 75/382 (20%)
MFS_1 32..397 CDD:284993 63/339 (19%)
SPAC11D3.18cNP_001342807.1 UhpC 68..461 CDD:332119 77/389 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.