DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and SPAC1039.04

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_594995.1 Gene:SPAC1039.04 / 2542960 PomBaseID:SPAC1039.04 Length:507 Species:Schizosaccharomyces pombe


Alignment Length:475 Identity:85/475 - (17%)
Similarity:140/475 - (29%) Gaps:165/475 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DEKLKYSLLRGELVDTQSIWTRH--EKRVWFITLITGTCMLYSTRTTMPLLVPAVASAQKWSKTD 64
            |::|......||.|.|:.....|  |:|:         |..:..|     ::|.:|....::..|
pombe    25 DQQLPIDFGEGEDVTTEVYILDHKAERRL---------CRKFDFR-----ILPLLALLYLFNALD 75

  Fly    65 SGTV----------------------LSSFFWGYTLTQVVGGYFSDRFGGQRVILFAAIGWSLIT 107
            ...|                      :|.|:..:.|......|...|||..|::.|..:.:..::
pombe    76 KSNVSNAKTNGMDKDLGFVGDQYNIMISIFYIPFVLCAFPFSYLYKRFGAARILPFFMLSFGAMS 140

  Fly   108 FL---------MPTIIWTAGSIKSYAIPFIVAIRILNGALQGVHFPSMISLTSQNLCPNERSSFF 163
            ..         |..:.|..|..:|..:|.:|..              :.:...:.......:.|:
pombe   141 LCQAAVKNFGGMMAVRWFLGMAESAVLPGVVYY--------------LTTFYRRTELARRLAIFY 191

  Fly   164 GLLTAGSALGTLLT----GIMGSFLLDYFGWSYVFRVIGLMGIAWALVLRYYAMAGERNRIINIA 224
            ......||.|.||.    .|.|..|.   ||.|:|.:.|  |:.:                    
pombe   192 AAANVSSAFGGLLAYGVFHIKGGKLQ---GWQYLFLIEG--GVTF-------------------- 231

  Fly   225 TPSRLCANKSPAETSAVPWLRYFRRLSFWACVLTHACEMNCFFVLLSWLPTYFHDGFPHAKGWVV 289
                |||                                                          
pombe   232 ----LCA---------------------------------------------------------- 234

  Fly   290 NMIPWLALPPCTLFAKYLTTRLLAREWHTTTVRKVIQSCCFAAQNLALFVMSRTSDFHTALICMT 354
             ::.:|.||.....|.:||.     |..|....::......|......|..|.|...|...|...
pombe   235 -IVIFLVLPVSVETANFLTD-----EEKTLAKMRIENDSSSAISEKLSFKQSLTVFKHPIAILWL 293

  Fly   355 IIIGGTGFHNNAVTVN--PQDLAPLHSGSV-FGLMNTVGAIPGFLGVYLAGHILELTQSWPMVFS 416
            :.....|...|::. |  ||.:|.:...|| ..||....||.|.:.:.:...|.:..::..:|..
pombe   294 LEEMALGVPLNSIN-NWLPQIVAAMGFSSVNTNLMTVAPAISGAIWLLVFAFISDFLKNRGIVLI 357

  Fly   417 AAAGINLVGWIIFIVFGSAE 436
            ||....::|   |||:||.:
pombe   358 AAISTTMIG---FIVYGSID 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 73/439 (17%)
MFS_1 32..397 CDD:284993 66/402 (16%)
SPAC1039.04NP_594995.1 MFS 71..471 CDD:119392 72/415 (17%)
2A0114 71..463 CDD:273326 72/415 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.