DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and SPAC1B3.15c

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_594800.1 Gene:SPAC1B3.15c / 2542116 PomBaseID:SPAC1B3.15c Length:628 Species:Schizosaccharomyces pombe


Alignment Length:327 Identity:70/327 - (21%)
Similarity:107/327 - (32%) Gaps:115/327 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IWTRHEKRVWF-----ITLITGTCMLYSTRTTMPLLVPAVASAQKWSKTDSGTVLSSFFWGYTLT 79
            :.||.:.|:|.     .|.|.|.|             .||...:  ..:.||.:...||.|..:.
pombe   222 LMTRADPRLWLSRIQVTTGIIGAC-------------HAVLGTK--GSSASGFIALRFFNGLAIA 271

  Fly    80 QVVGG-------YFSDRFGGQRVILFAAIGWSLITFLMPTIIWTAGSIKSYAIPFIVAIRILNGA 137
            .:..|       ::.|:..|:|      |||          .:||..|.|      ||..:|:.|
pombe   272 GMWPGFAFYTSRFYRDQHLGKR------IGW----------YYTAAQISS------VATSLLSAA 314

  Fly   138 LQ---GVH----------FPSMISLTSQNLCP-----------NER-------SSFFGLLTAGSA 171
            .|   |:|          ...:::.|.....|           ||:       ..|.|.|.|...
pombe   315 FQKMDGLHGLYGYQWMFLIWGVVAFTQGLFLPRWLPCIKHNQHNEKWISWIRIPKFLGFLKASEN 379

  Fly   172 LGT---------------------LLTGIMGSFLLDYFGWSYVFRVIGLMGIAWALVLRYYAMAG 215
            .|.                     .||.:..:| ||...|..:|...|::||:..||.....:..
pombe   380 TGLTPEEEEVHAIYMAEMQVGKSWTLTDLADAF-LDVRLWPPIFMFFGVVGISNGLVNYSSLIIS 443

  Fly   216 ERNRIINIATPSRLCANKSPAETSAVPWL-----RYFRRLSFWACVLTHACEMNCFFVLLSWLPT 275
            |.|...:..|.|.|.|.....:..|:..:     |:.:::.|:.        .:|.|||...|.|
pombe   444 EINENFSSVTVSLLVAPIWVFDAIAILTVLPLHDRFHKKMLFFV--------GSCLFVLAGLLIT 500

  Fly   276 YF 277
            .|
pombe   501 TF 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 66/317 (21%)
MFS_1 32..397 CDD:284993 66/310 (21%)
SPAC1B3.15cNP_594800.1 MFS 158..600 CDD:119392 70/327 (21%)
2A0114 190..600 CDD:273326 70/327 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.