DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and Slc17a5

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_766361.1 Gene:Slc17a5 / 235504 MGIID:1924105 Length:495 Species:Mus musculus


Alignment Length:408 Identity:115/408 - (28%)
Similarity:192/408 - (47%) Gaps:58/408 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KWSKTDSGTVLSSFFWGYTLTQVVGGYFSDRFGGQRVILFAAIGWSLITFLMPTIIWTAGSIKSY 123
            ||.....|.:|.|||:||.:||:.|||.:.|.||:.::....:|.|:.|...|.       ....
Mouse   102 KWDAETQGWILGSFFYGYIVTQIPGGYIASRVGGKLLLGLGILGTSVFTLFTPL-------AADL 159

  Fly   124 AIPFIVAIRILNGALQGVHFPSMISLTSQNLCPNERSSFFGLLTAGSALGTLLTGIMGSFLLDYF 188
            .:..:|.:|.|.|..:||.||:|.::.|....|.|||....:..||:.|||:::..:...:..|.
Mouse   160 GVVTLVVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLTISYAGAQLGTVISLPLSGIICYYM 224

  Fly   189 GWSYVFRVIGLMGIAWALV--------------LRYYAMAGERNRIINIATPSRLCANKSPAETS 239
            .|:|||.:.|::||.|.::              :.:|    |:..|:: :..::|.:.|      
Mouse   225 NWTYVFYLFGIVGIVWFILWMWIVSDTPETHKTISHY----EKEYIVS-SLKNQLSSQK------ 278

  Fly   240 AVPWLRYFRRLSFWACVLTHACEMNCFFVLLSWLPTYFHD--GFPHAKGWVVNMIP----WLALP 298
            .|||....:.|..||.|:.|......|:.||:.||||..:  .|...:...::.:|    ||.:.
Mouse   279 VVPWGSILKSLPLWAIVVAHFSYNWSFYTLLTLLPTYMKEILRFNVQENGFLSALPYFGCWLCMI 343

  Fly   299 PCTLFAKYLTTRLLAREWH--TTTVRKVIQSCCFAAQNL---ALFVMSR---TSDFHTALICMTI 355
            .|...|.||..:     |:  |.:||::     |:...:   |:|:::.   ..|:..|:..:||
Mouse   344 LCGQAADYLRVK-----WNFSTISVRRI-----FSLVGMVGPAVFLVAAGFIGCDYSLAVAFLTI 398

  Fly   356 IIGGTGFHNNAVTVNPQDLAPLHSGSVFGLMNTVGAIPGFLGVYLAGHIL--ELTQSWPMVFSAA 418
            .....||.::..::|..|:||.::|.:.|:.||...|||..|..:|..:.  ...:.|..||..|
Mouse   399 STTLGGFASSGFSINHLDIAPSYAGILLGITNTFATIPGMTGPIIAKSLTPDNTIREWQTVFCIA 463

  Fly   419 AGINLVGWIIFIVFGSAE 436
            |.||:.|.|.|.:|...|
Mouse   464 AAINVFGAIFFTLFAKGE 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 113/402 (28%)
MFS_1 32..397 CDD:284993 101/365 (28%)
Slc17a5NP_766361.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Dileucine internalization motif. /evidence=ECO:0000250 22..23
2A0114euk 30..491 CDD:129972 115/408 (28%)
MFS 99..478 CDD:119392 113/403 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53923
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.