DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and C18H9.5

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_495362.1 Gene:C18H9.5 / 174104 WormBaseID:WBGene00016003 Length:464 Species:Caenorhabditis elegans


Alignment Length:218 Identity:48/218 - (22%)
Similarity:87/218 - (39%) Gaps:49/218 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 WTRHEKRVWFITLITGTCMLYSTRTTMPLL------VPAVASAQK-------W-------SKTDS 65
            |.:....:.||.||..||    |...|.|:      :..|...||       |       |.|.|
 Worm    26 WGKTRFLILFIGLICITC----TNANMILMNFTVICMNDVIIEQKSFSNQTHWLEKSSDISLTFS 86

  Fly    66 GTVLSSFFWGYTLTQVVGGYFSDRFGGQRVI----LFAAIGWSLITFLMPTIIWTAGSIKSYA-I 125
            ...:.:.|.......::     .::|.::|:    |.:|.|    |.|||..:       :|. |
 Worm    87 AAAVGAIFGTVPAVTLI-----SKYGIRKVLTVYGLLSAGG----TLLMPLAV-------NYGLI 135

  Fly   126 PFIVAIRILNGALQGVHFPSMISLTSQNLCP-NERSSFFGLLTAGSALGTLLTGIMGSFLLD-YF 188
            |.::| |:..|....:.: |.|...|::..| ||..:|...|::...:..::|.....||.: ..
 Worm   136 PVLIA-RLFQGVGASILY-SSIGTISESWSPINEIGTFVAFLSSAFQISNIVTMPTAGFLCESSL 198

  Fly   189 GWSYVFRVIGLMGIAWALVLRYY 211
            ||..::.:.|.:.:.:.::..:|
 Worm   199 GWKSIYYIFGGITVIFYIIFLWY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 47/209 (22%)
MFS_1 32..397 CDD:284993 45/207 (22%)
C18H9.5NP_495362.1 2A0114euk 29..437 CDD:129972 47/215 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.