DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and Slc17a1

DIOPT Version :9

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_598238.2 Gene:Slc17a1 / 171080 RGDID:620099 Length:465 Species:Rattus norvegicus


Alignment Length:421 Identity:91/421 - (21%)
Similarity:178/421 - (42%) Gaps:49/421 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 STRTTMPLLVPAVASAQKWSKTDSGTVLSSFFWGYTLTQVVGGYFSDRFGGQRVI---LFAAIGW 103
            |.::...:|.........||....|.:|||.|.|..:.||..||.|..:..:::|   ||.:   
  Rat    55 SNKSVAEMLDNVKNPVHSWSLDIQGLILSSVFLGMVVIQVPVGYLSGAYPMKKIIGSSLFLS--- 116

  Fly   104 SLITFLMPTIIWTAGSIKSYAIPFIVAIRILNGALQGVHFPSMISLTSQNLCPNERSSFFGLLTA 168
            |:::.|:|.......::       ::..|:|.|..||........:..:...|.||.....:..:
  Rat   117 SVLSLLIPPAAQVGAAL-------VIVCRVLQGIAQGAVSTGQHGIWVKWAPPLERGRLTSMTLS 174

  Fly   169 GSALGTLLTGIMGSFLLDYFGWSYVFRVIGLMG----IAWALVL------RYYAMAGERNRIINI 223
            |..:|..:..::..|:.|..||..||.:.|::|    :.|.::.      ..|..:.|::.|   
  Rat   175 GFVMGPFIALLVSGFICDLLGWPMVFYIFGIVGCVLSLFWFILFFDDPNNHPYMSSSEKDYI--- 236

  Fly   224 ATPSRLCANKSPAETSAVPWLRYFRRLSFWACVLTHACEMNCF-FV-----LLSWLPTYFHDGFP 282
             |.|.:  .:..:...::|.....:.|..||.:|      |.| |:     |:::.||:..... 
  Rat   237 -TSSLM--QQVHSGRQSLPIKAMLKSLPLWAIIL------NSFAFIWSNNLLVTYTPTFISTTL- 291

  Fly   283 HA---KGWVVNMIPWLALPPCTLFAKYLTTRLLARE-WHTTTVRKVIQSC-CFAAQNLALFVMSR 342
            |.   :..:::.:|:|....|.:.|..::..||:|: :....|||:..:. .|......:.::..
  Rat   292 HVNVRENGLLSSLPYLLAYICGIVAGQMSDFLLSRKIFSVVAVRKLFTTLGIFCPVIFVVCLLYL 356

  Fly   343 TSDFHTALICMTIIIGGTGFHNNAVTVNPQDLAPLHSGSVFGLMNTVGAIPGFLGVYLAGHIL-- 405
            :.:|::.:|.:|:......|......:|..|:||.:.|.:..:...:|...|.:...|||.||  
  Rat   357 SYNFYSTVIFLTLANSTLSFSFCGQLINALDIAPRYYGFLKAVTALIGIFGGLISSTLAGLILNQ 421

  Fly   406 ELTQSWPMVFSAAAGINLVGWIIFIVFGSAE 436
            :...:|...|...||||:.....:::|...:
  Rat   422 DPEYAWHKNFFLMAGINVTCLAFYLLFAKGD 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS 30..432 CDD:119392 90/415 (22%)
MFS_1 32..397 CDD:284993 79/378 (21%)
Slc17a1NP_598238.2 2A0114euk 1..464 CDD:129972 91/421 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.