DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS18 and MFS3

DIOPT Version :10

Sequence 1:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_318686.3 Gene:MFS3 / 1279029 VectorBaseID:AGAMI1_001180 Length:515 Species:Anopheles gambiae


Alignment Length:31 Identity:10/31 - (32%)
Similarity:15/31 - (48%) Gaps:5/31 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VIRNIVEAAAV-----RDISDASVYSSYVLP 65
            ::|.:.|.|..     ..:.:.||.|||.||
Mosquito    31 IVREMKENACYLALDPTKVENNSVKSSYALP 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS18NP_608835.1 MFS_SLC17A9_like 31..433 CDD:340938 10/31 (32%)
MFS3XP_318686.3 MFS_SLC17 24..474 CDD:340876 10/31 (32%)

Return to query results.
Submit another query.