DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment morgue and UBC36

DIOPT Version :10

Sequence 1:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001185017.1 Gene:UBC36 / 838260 AraportID:AT1G16890 Length:162 Species:Arabidopsis thaliana


Alignment Length:153 Identity:59/153 - (38%)
Similarity:82/153 - (53%) Gaps:14/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 EPGNVMRNNFLRGEANLLNSYE-SEGISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPER 395
            |||            |.:.|:: |.||||.|.:....|:...||||..||||||.|.|.::.||.
plant    20 EPG------------NFITSFDPSPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFLPEE 72

  Fly   396 YPMTPPTVRFLTKILHPNVSRHGDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDPYTEVCMEPEL 460
            |||..|.|||||||.|||:.:.|.:.:||.:. .||.||.:..||||:|:||:.|..:..:...:
plant    73 YPMAAPKVRFLTKIYHPNIDKLGRICLDILKD-KWSPALQIRTVLLSIQALLSAPNPDDPLSENI 136

  Fly   461 GYIYEHERERFEQLVRAWTWKYA 483
            ...::.......:..:.||..||
plant   137 AKHWKSNEAEAVETAKEWTRLYA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
morgueNP_608833.1 PLN03029 <104..170 CDD:215544
F-box_SF 234..265 CDD:438852
UEV_Morgue-like 337..483 CDD:467436 54/146 (37%)
UBC36NP_001185017.1 UBCc_UBE2N 6..158 CDD:467433 57/150 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.