DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment morgue and UBC37

DIOPT Version :10

Sequence 1:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001325554.1 Gene:UBC37 / 822045 AraportID:AT3G24515 Length:434 Species:Arabidopsis thaliana


Alignment Length:114 Identity:43/114 - (37%)
Similarity:62/114 - (54%) Gaps:3/114 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 ILGPPGSPYEGGKFFLFIYFPERYPMTPPTVRFLTKILHPNVSRHGDVGIDIFQ---QHNWSLAL 434
            |.||..:.|..|.|.|.|..|||||..||.|.|.|.|.|||:...|.:.:||..   :..|..:|
plant    76 IEGPEDTVYANGIFNLKIQIPERYPFQPPIVSFATPIYHPNIDNSGRICLDILNLPPKGAWQPSL 140

  Fly   435 NVAKVLLSVQSLLTDPYTEVCMEPELGYIYEHERERFEQLVRAWTWKYA 483
            |::.||.|::.||::|..:..:..|:...|::.|:.|:...|..|.|||
plant   141 NISTVLTSMRLLLSEPNPDDGLMCEVSREYKYNRQTFDYKAREMTEKYA 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
morgueNP_608833.1 PLN03029 <104..170 CDD:215544
F-box_SF 234..265 CDD:438852
UEV_Morgue-like 337..483 CDD:467436 41/112 (37%)
UBC37NP_001325554.1 UBCc_UBE2T 10..188 CDD:467425 40/111 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.