DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment morgue and UBC29

DIOPT Version :10

Sequence 1:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_565391.1 Gene:UBC29 / 816175 AraportID:AT2G16740 Length:148 Species:Arabidopsis thaliana


Alignment Length:128 Identity:59/128 - (46%)
Similarity:87/128 - (67%) Gaps:1/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 SAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYPMTPPTVRFLTKILHPNVSRHGDVGI 422
            ||.|......:|||||:||..|||.||.|.:.|:||..||..||.|.|.||:.|||::.:|::.:
plant    22 SAGPTGEDMFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPPKVVFRTKVFHPNINSNGNICL 86

  Fly   423 DIFQQHNWSLALNVAKVLLSVQSLLTDPYTEVCMEPELGYIYEHERERFEQLVRAWTWKYAMY 485
            ||.:. .||.||.::|||||:.||||||..:..:.||:.:||:.::.::|.:.|:||.|||::
plant    87 DILKD-QWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHIYKTDKTKYEAMARSWTQKYALF 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
morgueNP_608833.1 PLN03029 <104..170 CDD:215544
F-box_SF 234..265 CDD:438852
UEV_Morgue-like 337..483 CDD:467436 57/124 (46%)
UBC29NP_565391.1 UBCc_UBE2D 3..145 CDD:467412 56/123 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.