DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment morgue and UBE2E1

DIOPT Version :9

Sequence 1:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_003332.1 Gene:UBE2E1 / 7324 HGNCID:12477 Length:193 Species:Homo sapiens


Alignment Length:120 Identity:57/120 - (47%)
Similarity:74/120 - (61%) Gaps:11/120 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 WQATILGPPGSPYEGGKFFLFIYFPERYPMTPPTVRFLTKILHPNVSRHGDVGIDIFQQHNWSLA 433
            |::||||||||.||||.|||.|.|...||..||.|.|.|:|.|.|::..|.:.:||.:. |||.|
Human    79 WRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKD-NWSPA 142

  Fly   434 LNVAKVLLSVQSLLTDPYTEVC--MEPELGYI---YEHERERFEQLVRAWTWKYA 483
            |.::|||||:.|||||     |  .:|.:|.|   |...|...:::.|.||.:||
Human   143 LTISKVLLSICSLLTD-----CNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
morgueNP_608833.1 DUF3664 92..190 CDD:289191
F-box-like 234..275 CDD:289689
UQ_con 342..479 CDD:278603 53/114 (46%)
COG5078 355..485 CDD:227410 57/120 (48%)
UBE2E1NP_003332.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
UQ_con 51..188 CDD:395127 53/114 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.