DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment morgue and ube2i

DIOPT Version :9

Sequence 1:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001016408.1 Gene:ube2i / 549162 XenbaseID:XB-GENE-974017 Length:158 Species:Xenopus tropicalis


Alignment Length:141 Identity:45/141 - (31%)
Similarity:69/141 - (48%) Gaps:19/141 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 GEANLLNSYESEGISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYPMTPPTVRFLTK 408
            |..||:|                  |:..|.|..|:|:|||.|.|.:.|.:.||.:||..:|...
 Frog    34 GTMNLMN------------------WECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP 80

  Fly   409 ILHPNVSRHGDVGIDIFQQ-HNWSLALNVAKVLLSVQSLLTDPYTEVCMEPELGYIYEHERERFE 472
            :.||||...|.|.:.|.:: .:|..|:.:.::||.:|.||.:|..:...:.|...||...|..:|
 Frog    81 LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYE 145

  Fly   473 QLVRAWTWKYA 483
            :.|||...|:|
 Frog   146 KRVRAQAKKFA 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
morgueNP_608833.1 DUF3664 92..190 CDD:289191
F-box-like 234..275 CDD:289689
UQ_con 342..479 CDD:278603 43/135 (32%)
COG5078 355..485 CDD:227410 41/130 (32%)
ube2iNP_001016408.1 UQ_con 8..152 CDD:395127 43/135 (32%)
Interaction with sumo1. /evidence=ECO:0000250 13..18
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.