DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment morgue and ube2k

DIOPT Version :9

Sequence 1:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001005662.1 Gene:ube2k / 448153 XenbaseID:XB-GENE-983372 Length:200 Species:Xenopus tropicalis


Alignment Length:164 Identity:58/164 - (35%)
Similarity:81/164 - (49%) Gaps:14/164 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 NVMRNNFLRGEANLLNSYES--EGISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYP 397
            |:......|....:|.|.|:  ..|....:|...:..:..|.|||.:|||||::.|.|..||.||
 Frog     3 NIAAQRIKREFKEVLKSEETSKNQIKVDLVDENFSELRGEIAGPPDTPYEGGRYQLEIKIPETYP 67

  Fly   398 MTPPTVRFLTKILHPNVSR-HGDVGIDIFQQHNWSLALNVAKVLLSVQSLLT-----DPYTEVCM 456
            ..||.|||:|||.|||:|. .|.:.:||.:. .|:.|:.:..||||:|:||.     ||...|..
 Frog    68 FNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVA 131

  Fly   457 EPELGYIYEHERERFEQLVRAWTWKYAMYELIAP 490
            ..     |:...|.|:|..|.|...||...:.:|
 Frog   132 NQ-----YKQNPEMFKQTARLWAHVYAGAPVTSP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
morgueNP_608833.1 DUF3664 92..190 CDD:289191
F-box-like 234..275 CDD:289689
UQ_con 342..479 CDD:278603 53/144 (37%)
COG5078 355..485 CDD:227410 52/135 (39%)
ube2kNP_001005662.1 UQ_con 8..149 CDD:365926 53/146 (36%)
UBA_II_E2_UBE2K 163..200 CDD:270573
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.