DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment morgue and CG5823

DIOPT Version :9

Sequence 1:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster


Alignment Length:153 Identity:40/153 - (26%)
Similarity:66/153 - (43%) Gaps:23/153 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 GDREPGNV--MRNNFLRGEANLLNSYESEGISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIY 391
            |.::|..|  |:.:::|.:.:.| .|    |:|.||......|...:.||..|||.||.:...:.
  Fly     9 GRKQPTAVSRMKQDYMRLKRDPL-PY----ITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLL 68

  Fly   392 FPERYPMTPPTVRFLTKILHPN----VSRHGDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDPYT 452
            ||..:|..||::..||    ||    .:....:.|..|....|:....|..:|..:.|.:.:   
  Fly    69 FPREFPFKPPSIYMLT----PNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLE--- 126

  Fly   453 EVCMEPELGYI--YEHERERFEQ 473
               ..|.||.|  ..::::.|.|
  Fly   127 ---STPTLGSIESSNYDKQMFAQ 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
morgueNP_608833.1 DUF3664 92..190 CDD:289191
F-box-like 234..275 CDD:289689
UQ_con 342..479 CDD:278603 36/138 (26%)
COG5078 355..485 CDD:227410 33/125 (26%)
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 32/127 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.