DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment morgue and eff

DIOPT Version :10

Sequence 1:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_731941.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster


Alignment Length:127 Identity:64/127 - (50%)
Similarity:87/127 - (68%) Gaps:1/127 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 SAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYPMTPPTVRFLTKILHPNVSRHGDVGI 422
            ||.|:.....:|||||:|||.|||:||.|||.|:||..||..||.|.|.|:|.|||::.:|.:.:
  Fly    22 SAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICL 86

  Fly   423 DIFQQHNWSLALNVAKVLLSVQSLLTDPYTEVCMEPELGYIYEHERERFEQLVRAWTWKYAM 484
            ||.:. .||.||.::|||||:.|||.||..:..:.||:..||:.:||::.:|.|.||.||||
  Fly    87 DILRS-QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYAM 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
morgueNP_608833.1 PLN03029 <104..170 CDD:215544
F-box_SF 234..265 CDD:438852
UEV_Morgue-like 337..483 CDD:467436 61/124 (49%)
effNP_731941.1 UBCc_UBE2D 3..145 CDD:467412 60/123 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.