DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment morgue and Ubc84D

DIOPT Version :10

Sequence 1:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster


Alignment Length:145 Identity:41/145 - (28%)
Similarity:69/145 - (47%) Gaps:8/145 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 NNFLRGEANLLNSYESEGISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYPMTPPTV 403
            ::.:..:.:.|.:.||...|.:       .|.. :|.|..:||..|.|.:.|.||.:||..||.:
  Fly    12 SDLVEAKMSTLRNIESSDESLL-------MWTG-LLVPEKAPYNKGAFRIEINFPPQYPFMPPKI 68

  Fly   404 RFLTKILHPNVSRHGDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDPYTEVCMEPELGYIYEHER 468
            .|.|||.||||...|:|.:.|....||.......:||.::.:::.:|..|..:..:|...:..|.
  Fly    69 LFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFVREH 133

  Fly   469 ERFEQLVRAWTWKYA 483
            ::|.:....:|.|.|
  Fly   134 KKFMKTAEEFTKKNA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
morgueNP_608833.1 PLN03029 <104..170 CDD:215544
F-box_SF 234..265 CDD:438852
UEV_Morgue-like 337..483 CDD:467436 40/143 (28%)
Ubc84DNP_524260.1 UBCc_UBE2L3 3..149 CDD:467421 41/145 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.