DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment morgue and ube2nb

DIOPT Version :9

Sequence 1:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_956636.1 Gene:ube2nb / 393313 ZFINID:ZDB-GENE-040426-1291 Length:154 Species:Danio rerio


Alignment Length:128 Identity:51/128 - (39%)
Similarity:73/128 - (57%) Gaps:1/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 GISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYPMTPPTVRFLTKILHPNVSRHGDV 420
            ||.|.|.:....|:...|.||..||:|||.|.|.::.||.|||..|.|||:|||.||||.:.|.:
Zfish    22 GIKAEPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRI 86

  Fly   421 GIDIFQQHNWSLALNVAKVLLSVQSLLTDPYTEVCMEPELGYIYEHERERFEQLVRAWTWKYA 483
            .:||.:. .||.||.:..||||:|:||:.|..:..:..::...::....:..:..|.||..||
Zfish    87 CLDILKD-KWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKSNEAQAIETARTWTRLYA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
morgueNP_608833.1 DUF3664 92..190 CDD:289191
F-box-like 234..275 CDD:289689
UQ_con 342..479 CDD:278603 47/122 (39%)
COG5078 355..485 CDD:227410 51/128 (40%)
ube2nbNP_956636.1 UBCc 4..151 CDD:412187 51/128 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.