DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment morgue and Ubc4

DIOPT Version :9

Sequence 1:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster


Alignment Length:164 Identity:61/164 - (37%)
Similarity:84/164 - (51%) Gaps:32/164 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 REPGNVMRNNFLRGEANLLNSYESEGI--SAIPLDRQNNYW---QATILGPPGSPYEGGKFFLFI 390
            ||...|||               ||.|  .:|.::..|:.|   :..|.|||.:|||||||.|.|
  Fly    11 REFKEVMR---------------SEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEI 60

  Fly   391 YFPERYPMTPPTVRFLTKILHPNVSR-HGDVGIDIFQQHNWSLALNVAKVLLSVQSLLT-----D 449
            ..||.||..||.|||:|:|.|||:|. .|.:.:||.:. ||:.|:.:..||||:|:||.     |
  Fly    61 KVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILKD-NWAAAMTLRTVLLSLQALLAAAEPDD 124

  Fly   450 PYTEVCMEPELGYIYEHERERFEQLVRAWTWKYA 483
            |...|     :.|.::.:.:.|....:.||..||
  Fly   125 PQDAV-----VAYQFKDKYDLFLLTAKHWTNAYA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
morgueNP_608833.1 DUF3664 92..190 CDD:289191
F-box-like 234..275 CDD:289689
UQ_con 342..479 CDD:278603 52/147 (35%)
COG5078 355..485 CDD:227410 55/140 (39%)
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 59/162 (36%)
UQ_con 8..149 CDD:278603 57/158 (36%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.