DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment morgue and CG10862

DIOPT Version :9

Sequence 1:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster


Alignment Length:158 Identity:61/158 - (38%)
Similarity:87/158 - (55%) Gaps:6/158 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 PQLGDREPGNVMRNNFLRGEANLLNSYESEGISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFI 390
            |..||  |..:.|   ||.|.:..::.::||..|..:.....:|.|||.||..:.||||:|.:.|
  Fly   202 PTQGD--PLTITR---LRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEI 261

  Fly   391 YFPERYPMTPPTVRFLTKILHPNVSRHGDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDPYTEVC 455
            .||..||..||.:.||||..|.|::..|.:.:||... .||.||:|:|||:|:.|||.||.....
  Fly   262 VFPRNYPFYPPYLAFLTKTYHCNIALSGRICLDILGS-KWSPALSVSKVLISIMSLLADPNPHDP 325

  Fly   456 MEPELGYIYEHERERFEQLVRAWTWKYA 483
            ||..:..:::..|...::..|.||.|||
  Fly   326 MEVSVADVFKGNRALHDKNAREWTKKYA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
morgueNP_608833.1 DUF3664 92..190 CDD:289191
F-box-like 234..275 CDD:289689
UQ_con 342..479 CDD:278603 51/136 (38%)
COG5078 355..485 CDD:227410 53/129 (41%)
CG10862NP_647823.1 COG5078 207..354 CDD:227410 58/151 (38%)
UQ_con 212..349 CDD:278603 52/140 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.