DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment morgue and Ubc2

DIOPT Version :9

Sequence 1:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster


Alignment Length:195 Identity:75/195 - (38%)
Similarity:95/195 - (48%) Gaps:38/195 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 GGRGQDAQEADPQLGDREPGNVMRNNFLRGEANLL-NSYESEGISA---------IPLDRQNN-- 367
            ||||.:|.      |.....|....:..|.||... ....:.|.||         |.||...|  
  Fly    49 GGRGSNAN------GGASGSNAGGGDEPRKEAKTTPRISRALGTSAKRIQKELAEITLDPPPNCS 107

  Fly   368 ---------YWQATILGPPGSPYEGGKFFLFIYFPERYPMTPPTVRFLTKILHPNVSRHGDVGID 423
                     .|.:||||||||.||||.|||.|:|...||..||.|.|.|:|.|.|::..|.:.:|
  Fly   108 AGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNINSQGVICLD 172

  Fly   424 IFQQHNWSLALNVAKVLLSVQSLLTDPYTEVC--MEPELGYI---YEHERERFEQLVRAWTWKYA 483
            |.:. |||.||.::|||||:.|||||     |  .:|.:|.|   |...||..:::.|.||.:||
  Fly   173 ILKD-NWSPALTISKVLLSICSLLTD-----CNPADPLVGSIATQYLQNREEHDRIARLWTKRYA 231

  Fly   484  483
              Fly   232  231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
morgueNP_608833.1 DUF3664 92..190 CDD:289191
F-box-like 234..275 CDD:289689
UQ_con 342..479 CDD:278603 64/162 (40%)
COG5078 355..485 CDD:227410 65/154 (42%)
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 62/150 (41%)
UQ_con 90..227 CDD:278603 58/142 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.