DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment morgue and CG4502

DIOPT Version :9

Sequence 1:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster


Alignment Length:294 Identity:49/294 - (16%)
Similarity:100/294 - (34%) Gaps:97/294 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 AASGSGASGSSRNIVNIIPVEVMLKIFAYLDDMSLWMASEVCKQWHDIVGKNTAQSMWKAYIKQR 281
            |...||:||:::|.|                   :.||:|              |::|       
  Fly    85 AVGSSGSSGAAKNAV-------------------VRMAAE--------------QAVW------- 109

  Fly   282 WPLFDSLADNPNWYRLYGALMSSCFCRTCLIEMGGRGQDAQEADPQLGDRE----PGNVMRNNFL 342
                    |:|                      |.|.:...:..|.. :|:    |.:.:|...|
  Fly   110 --------DSP----------------------GKRRRQDHKVAPTT-ERQLVAAPDHTIRTRRL 143

  Fly   343 RGEANLLNSYESEGISAIPLDRQNN---YWQATI-LGPPGSPY-----EGG--KFFLFIYFPERY 396
            ..|...:...:::..:...::..|:   .|...: :..|.||.     |.|  ...|.:.||:.:
  Fly   144 MKEYREMERLQAKNDAVFTVELVNDSLFEWHVRLHVIDPDSPLARDMAEMGVPAILLHLSFPDNF 208

  Fly   397 PMTPPTVRFLTKILHPNVSR-----HGDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDPYTEVCM 456
            |..||.:|    ::.|::.:     .|.:.:::.....|:.|..|..|::...:.:......:..
  Fly   209 PFAPPFMR----VVEPHIEKGYVMEGGAICMELLTPRGWASAYTVEAVIMQFAASVVKGQGRIAR 269

  Fly   457 EPELGYIYEHERERFEQLVRAWTWKYAMYELIAP 490
            :|:  ...|..|.:.|:..|:....:..|..:.|
  Fly   270 KPK--STKEFTRRQAEESFRSLVKTHEKYGWVTP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
morgueNP_608833.1 DUF3664 92..190 CDD:289191
F-box-like 234..275 CDD:289689 4/40 (10%)
UQ_con 342..479 CDD:278603 27/152 (18%)
COG5078 355..485 CDD:227410 25/145 (17%)
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 22/121 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.