DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment morgue and CG8188

DIOPT Version :10

Sequence 1:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_573237.2 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster


Alignment Length:144 Identity:44/144 - (30%)
Similarity:72/144 - (50%) Gaps:7/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 VMRNNFLRGEANLLNSYESEGISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYPMTP 400
            |||      |...:.:...|||..:..:......||.|.||.|:||..|.|.:.:...:.:|:||
  Fly    19 VMR------ELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYAAGIFRVKLTLNKDFPLTP 77

  Fly   401 PTVRFLTKILHPNVSRHGDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDPYTEVCMEPELGYIYE 465
            |...|||||.||||:.:|::.::..:: :|...|.:..:||:::.||..|..|..:..|.|.:..
  Fly    78 PKAYFLTKIFHPNVAANGEICVNTLKK-DWKPDLGIKHILLTIKCLLIVPNPESALNEEAGKMLL 141

  Fly   466 HERERFEQLVRAWT 479
            ...:.:.|..|..|
  Fly   142 ERYDDYSQRARMMT 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
morgueNP_608833.1 PLN03029 <104..170 CDD:215544
F-box_SF 234..265 CDD:438852
UEV_Morgue-like 337..483 CDD:467436 43/143 (30%)
CG8188NP_573237.2 UBCc_UBE2S 13..158 CDD:467424 44/144 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.