Sequence 1: | NP_608833.1 | Gene: | morgue / 33648 | FlyBaseID: | FBgn0027609 | Length: | 491 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_955958.1 | Gene: | ube2d1b / 324015 | ZFINID: | ZDB-GENE-030131-2735 | Length: | 147 | Species: | Danio rerio |
Alignment Length: | 127 | Identity: | 63/127 - (49%) |
---|---|---|---|
Similarity: | 87/127 - (68%) | Gaps: | 1/127 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 358 SAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYPMTPPTVRFLTKILHPNVSRHGDVGI 422
Fly 423 DIFQQHNWSLALNVAKVLLSVQSLLTDPYTEVCMEPELGYIYEHERERFEQLVRAWTWKYAM 484 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
morgue | NP_608833.1 | DUF3664 | 92..190 | CDD:289191 | |
F-box-like | 234..275 | CDD:289689 | |||
UQ_con | 342..479 | CDD:278603 | 57/120 (48%) | ||
COG5078 | 355..485 | CDD:227410 | 63/127 (50%) | ||
ube2d1b | NP_955958.1 | UBCc | 1..146 | CDD:412187 | 60/124 (48%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0417 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |